BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_G06 (386 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC336.08 |spc24||spindle pole body protein Spc24|Schizosacchar... 26 1.8 SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces... 25 3.1 SPBC56F2.07c |||AAA family ATPase, unknown biological role|Schiz... 25 5.5 SPBC27B12.08 |||AP-1 accessory protein |Schizosaccharomyces pomb... 24 7.2 SPAC694.02 |||DEAD/DEAH box helicase|Schizosaccharomyces pombe|c... 24 9.6 SPCC1795.09 |yps1||aspartic protease Yps1|Schizosaccharomyces po... 24 9.6 SPAC3C7.06c |pit1||serine/threonine protein kinase Pit1|Schizosa... 24 9.6 >SPBC336.08 |spc24||spindle pole body protein Spc24|Schizosaccharomyces pombe|chr 2|||Manual Length = 198 Score = 26.2 bits (55), Expect = 1.8 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 222 FEVGPEIINCENINDIKVQLDSELENAL 305 F++ P++ NI DI+ Q+ S E L Sbjct: 16 FQIAPDVKTISNIQDIRAQIQSFREKEL 43 >SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 3131 Score = 25.4 bits (53), Expect = 3.1 Identities = 19/51 (37%), Positives = 22/51 (43%) Frame = +3 Query: 204 STGVLHFEVGPEIINCENINDIKVQLDSELENALRRDPDAKANKPAFEAKQ 356 S L F G I NI+D VQL+S L R AN+ A KQ Sbjct: 2632 SNPTLDFMTGILISTLGNIHDAPVQLNSILLENARGTLSEMANRVASHYKQ 2682 >SPBC56F2.07c |||AAA family ATPase, unknown biological role|Schizosaccharomyces pombe|chr 2|||Manual Length = 809 Score = 24.6 bits (51), Expect = 5.5 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = -2 Query: 130 NFDFSPNSITMFPTIFRSAFVFNTTDLVFVSIRKSKIFWFFN 5 NFD P+++T A + D+V + + ++F FFN Sbjct: 268 NFDGPPSAVTFSSIGGLQAQIAQIRDIVELPFQNPELFKFFN 309 >SPBC27B12.08 |||AP-1 accessory protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 1919 Score = 24.2 bits (50), Expect = 7.2 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -2 Query: 181 YFAAPTLVACAV*VPENNFDFSPNSITMFPTIFRSAFVFNTTD 53 ++AA L C V N + + I+ + R+AFV +T+D Sbjct: 1217 FYAATCLKTCISEVMAENKEPAKYLISRISDLVRAAFVLSTSD 1259 >SPAC694.02 |||DEAD/DEAH box helicase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1717 Score = 23.8 bits (49), Expect = 9.6 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 371 LSNKRLLRFKSGLISFCV 318 L K L RFKS ++FC+ Sbjct: 61 LLEKELARFKSARLNFCI 78 >SPCC1795.09 |yps1||aspartic protease Yps1|Schizosaccharomyces pombe|chr 3|||Manual Length = 521 Score = 23.8 bits (49), Expect = 9.6 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = -2 Query: 136 ENNFDFSPNSITMFPTIFRSAFVFNTT 56 + ++ +SP+ IT FP +S + TT Sbjct: 44 KRDYTYSPSGITSFPLDLQSYTYYTTT 70 >SPAC3C7.06c |pit1||serine/threonine protein kinase Pit1|Schizosaccharomyces pombe|chr 1|||Manual Length = 650 Score = 23.8 bits (49), Expect = 9.6 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 243 LSLGQLQNAVHRWSPSLNHIHT 178 L+L Q+Q+ + + LNHIHT Sbjct: 133 LTLEQVQDIMRQIFKGLNHIHT 154 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,540,394 Number of Sequences: 5004 Number of extensions: 28513 Number of successful extensions: 71 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 128344734 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -