BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_G04 (531 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 23 1.3 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 22 2.9 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 6.8 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 21 8.9 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 23.4 bits (48), Expect = 1.3 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -2 Query: 335 SFIDESNPDVRRYLLFLVKATEET 264 +FI+ESN + ++ LFL+ ET Sbjct: 183 NFINESNVETVKFNLFLLSQAVET 206 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 22.2 bits (45), Expect = 2.9 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 203 YGTLSPIGVSIHSRT 247 Y TLSP+ S+HS + Sbjct: 396 YNTLSPLPSSVHSHS 410 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.0 bits (42), Expect = 6.8 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +2 Query: 257 APKSPQSLSRETVSISLHRDWTRQ*SYGSWLV 352 A + P S+ + S + + T+ YGSW + Sbjct: 206 AKERPDSIYQREYSPTFTQQQTQYSQYGSWFL 237 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 20.6 bits (41), Expect = 8.9 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +2 Query: 356 DVSYNIQAPGQLVNKTT*LKRYSTTRKITFCSRMRQRRL 472 DV + + +PG V + +K TTRK + RRL Sbjct: 100 DVPHGMGSPGVNVPEYPWMKEKKTTRKSSQQENGLPRRL 138 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,329 Number of Sequences: 336 Number of extensions: 2720 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12887571 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -