BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_G04 (531 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 4.8 AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. 23 6.4 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.4 bits (48), Expect = 4.8 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -1 Query: 270 GDFGAVVRVRECIETPIGDSVP*FHGTVSATAREILTVRRE 148 GD G ++ ++ + GD FH VS A+ +L VR + Sbjct: 2 GDNGNRLQYQQLLNVSFGDEFEVFHTQVS--AQHVLLVRNQ 40 >AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. Length = 437 Score = 23.0 bits (47), Expect = 6.4 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -2 Query: 386 VPAPVYCMRHLLLANSHSFIDESNPDVRRYLLFLVKA 276 VP P L+ + IDESN ++++Y +VK+ Sbjct: 397 VPKPCCAPTKLIPISVLYHIDESNVNLKKYKNMVVKS 433 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 582,783 Number of Sequences: 2352 Number of extensions: 11948 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49051644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -