BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_G03 (560 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22A12.11 |dak1||dihydroxyacetone kinase Dak1|Schizosaccharom... 27 2.5 SPAC11E3.01c |swr1|SPAC2H10.03c|SNF2 family helicase Swr1|Schizo... 26 4.4 >SPAC22A12.11 |dak1||dihydroxyacetone kinase Dak1|Schizosaccharomyces pombe|chr 1|||Manual Length = 580 Score = 26.6 bits (56), Expect = 2.5 Identities = 16/68 (23%), Positives = 29/68 (42%), Gaps = 1/68 (1%) Frame = +3 Query: 96 GRVVFPDEVDAIKEAAAENKVDVEAGDSNSVEET-PADPTLTSRNMITAPANCPAGYQMG 272 G V + +K +K V NS+E A+P +T + + +C + G Sbjct: 364 GNVSIEEGQKDVKSPVTVDKEKVRQAIVNSMENLIKAEPKITKFDTMAGDGDCGTTLKRG 423 Query: 273 SDGVCRLV 296 ++GV + V Sbjct: 424 AEGVLKFV 431 >SPAC11E3.01c |swr1|SPAC2H10.03c|SNF2 family helicase Swr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1288 Score = 25.8 bits (54), Expect = 4.4 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 4/60 (6%) Frame = +3 Query: 69 LKRTMADDSGRVVFPDEVDAIKEAAAENKVDVEAGD----SNSVEETPADPTLTSRNMIT 236 LK+ AD +E + AAAE++ DV+A +++E+T T T + M+T Sbjct: 1165 LKKVKADSDSGSTKNEENWEVALAAAEDEEDVQAAQVARKESALEQTEFSETSTPQAMLT 1224 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,768,127 Number of Sequences: 5004 Number of extensions: 29101 Number of successful extensions: 68 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 236012634 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -