BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_F24 (445 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0219 + 15822050-15824896 27 5.1 03_05_0517 - 25118232-25118730,25119002-25119273 27 5.1 12_02_0216 + 15804110-15804284,15804341-15804351 27 9.0 03_02_0721 - 10677286-10678018,10679293-10679373,10682516-106826... 27 9.0 >12_02_0219 + 15822050-15824896 Length = 948 Score = 27.5 bits (58), Expect = 5.1 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +2 Query: 8 DTIRQ*KLSC-FSSSPYWPWLPQTEFHRTAIV 100 D +R+ ++ C F+ P WPWL + T ++ Sbjct: 272 DPLRKHEMHCRFTQGPPWPWLAVASSYGTLVI 303 >03_05_0517 - 25118232-25118730,25119002-25119273 Length = 256 Score = 27.5 bits (58), Expect = 5.1 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +1 Query: 124 DPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYP 222 D FF++ P GN T P VD P P Sbjct: 37 DWFFTRKGESPQGNISKEETAPTGVDVTDPGRP 69 >12_02_0216 + 15804110-15804284,15804341-15804351 Length = 61 Score = 26.6 bits (56), Expect = 9.0 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +1 Query: 82 PSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAF 195 P+ +H V FF+ SN SGNY + G F Sbjct: 15 PAPPYKNHTVAGADGWFFNATSNTTSGNYSDWAAGETF 52 >03_02_0721 - 10677286-10678018,10679293-10679373,10682516-10682645, 10682969-10683101 Length = 358 Score = 26.6 bits (56), Expect = 9.0 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +1 Query: 76 RVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGP 189 R SD V+ +P+ SQP+NG SG GP Sbjct: 210 RAQSDEARSGSVVVDPEEPSSQPNNGSSGGGGGTPDGP 247 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,059,707 Number of Sequences: 37544 Number of extensions: 180009 Number of successful extensions: 418 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 410 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 418 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 847740284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -