BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_F24 (445 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8894| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.0 SB_44915| Best HMM Match : VWA (HMM E-Value=0) 27 7.0 SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) 27 7.0 SB_13163| Best HMM Match : VWA (HMM E-Value=2.3e-32) 27 7.0 SB_39378| Best HMM Match : VWA (HMM E-Value=0) 27 7.0 SB_20719| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.0 >SB_8894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 28.3 bits (60), Expect = 3.0 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +1 Query: 196 VDFNHPNYPPERYD 237 VD NHPNY PE Y+ Sbjct: 32 VDLNHPNYLPETYN 45 >SB_44915| Best HMM Match : VWA (HMM E-Value=0) Length = 541 Score = 27.1 bits (57), Expect = 7.0 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +1 Query: 109 VIANPDPFFSQP-SNGPSGNYEPISTG 186 VIA PDP S+P +NG G PIS+G Sbjct: 258 VIAEPDPCLSKPCANG--GTCSPISSG 282 >SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) Length = 769 Score = 27.1 bits (57), Expect = 7.0 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +1 Query: 181 TGPAFVDFNHPNYPPER 231 T AF D +PN+PPER Sbjct: 114 TNEAFFDLLNPNFPPER 130 >SB_13163| Best HMM Match : VWA (HMM E-Value=2.3e-32) Length = 318 Score = 27.1 bits (57), Expect = 7.0 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +1 Query: 109 VIANPDPFFSQP-SNGPSGNYEPISTG 186 VIA PDP S+P +NG G PIS+G Sbjct: 54 VIAEPDPCLSKPCANG--GTCSPISSG 78 >SB_39378| Best HMM Match : VWA (HMM E-Value=0) Length = 2865 Score = 27.1 bits (57), Expect = 7.0 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +1 Query: 109 VIANPDPFFSQP-SNGPSGNYEPISTG 186 VIA PDP S+P +NG G PIS+G Sbjct: 409 VIAEPDPCLSKPCANG--GTCSPISSG 433 >SB_20719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 27.1 bits (57), Expect = 7.0 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = +1 Query: 79 VPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPERY 234 +P DGN IAN D PSN P ++ + A V+ +PP Y Sbjct: 87 IPEDGNGCAAYIANVD-----PSNKPGSHWLAVYFTYANVNGESFRFPPHAY 133 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,598,594 Number of Sequences: 59808 Number of extensions: 204672 Number of successful extensions: 523 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 522 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 871599479 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -