BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_F24 (445 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 31 0.46 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 28 2.5 At5g25580.1 68418.m03044 expressed protein 27 4.3 At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family... 27 4.3 At4g15393.1 68417.m02352 cytochrome P450 family protein similar ... 27 4.3 At2g23260.1 68415.m02778 UDP-glucoronosyl/UDP-glucosyl transfera... 27 4.3 At1g44446.2 68414.m05114 chlorophyll a oxygenase (CAO) / chlorop... 27 7.5 At5g19690.1 68418.m02342 oligosaccharyl transferase STT3 subunit... 26 10.0 At3g50420.1 68416.m05515 pentatricopeptide (PPR) repeat-containi... 26 10.0 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 30.7 bits (66), Expect = 0.46 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +1 Query: 109 VIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPERYDNPLARGG 258 ++A P P+ P+ GP P+S+ PA N+P Y P GG Sbjct: 245 MMAPPPPYGQPPNAGPFTGNSPLSSPPAHSIPPPTNFPGVPYGRPPMPGG 294 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 28.3 bits (60), Expect = 2.5 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +1 Query: 121 PDPFFSQPSNGPSG--NYEPISTGPAFVDFNHPNYPPERYDNPLAR 252 P P S P N P ++ P + P+ +N P PP YD P R Sbjct: 357 PYPQQSYPPNPPRQPPSHPPPGSAPSQQYYNAPPTPPSMYDGPGGR 402 >At5g25580.1 68418.m03044 expressed protein Length = 405 Score = 27.5 bits (58), Expect = 4.3 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 35 CFSSSPYWPWLPQTEFHRT 91 C +P+WPW+ + E H T Sbjct: 119 CKKLAPWWPWIAKGEIHIT 137 >At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family protein Length = 421 Score = 27.5 bits (58), Expect = 4.3 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 142 PSNGPSGNYEPISTGPAFVDFNHP-NYPPERYDNP 243 PS+ PS ++ P TGP+ + HP ++ P D P Sbjct: 236 PSSYPSNDHLPPPTGPSDSPYPHPYSHQPYHQDPP 270 >At4g15393.1 68417.m02352 cytochrome P450 family protein similar to Cytochrome P450 90C1 (ROTUNDIFOLIA3) (SP:Q9M066) [Arabidopsis thaliana]; contains Pfam PF00067: Cytochrome P450 Length = 399 Score = 27.5 bits (58), Expect = 4.3 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +1 Query: 160 GNYEPISTGPAFVDFNHPNYPPERYDNPLA 249 G+Y I G F+ + + ++ PE+YD+PLA Sbjct: 363 GDYT-IPAGWIFMGYPYVHFNPEKYDDPLA 391 >At2g23260.1 68415.m02778 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 456 Score = 27.5 bits (58), Expect = 4.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 5 SDTIRQ*KLSCFSSSPYWPWLP 70 S I + + SC SSP+ PW+P Sbjct: 96 SKIIEEKRYSCIISSPFTPWVP 117 >At1g44446.2 68414.m05114 chlorophyll a oxygenase (CAO) / chlorophyll b synthase identical to chlorophyll a oxygenase GI:5853117 from [Arabidopsis thaliana]; contains Pfam PF00355 Rieske [2Fe-2S] domain Length = 511 Score = 26.6 bits (56), Expect = 7.5 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -2 Query: 303 FLLVLKSLIFMRHLLPTTGERVVVSLGWIIGMIEIDERRSSAYGFIIS 160 F +LK+L FM HL E+V V WI + + +Y F IS Sbjct: 462 FAPILKNLPFMEHLWRHFAEQVKVHHKWIDHLQPSSQSCFLSYRFYIS 509 >At5g19690.1 68418.m02342 oligosaccharyl transferase STT3 subunit family protein similar to SP|P39007 Oligosaccharyl transferase STT3 subunit {Saccharomyces cerevisiae}; contains Pfam profile PF02516: Oligosaccharyl transferase STT3 subunit Length = 779 Score = 26.2 bits (55), Expect = 10.0 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 Query: 292 FKIAHLYETFTSHH 251 FK+ H E FTSHH Sbjct: 725 FKLTHFEEVFTSHH 738 >At3g50420.1 68416.m05515 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 794 Score = 26.2 bits (55), Expect = 10.0 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -2 Query: 84 WNSVCGSHGQYGEEEKHESFHCRIV 10 WNS+ G++ Q+G EK SF +I+ Sbjct: 572 WNSMLGAYSQHGMVEKALSFFEQIL 596 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,248,750 Number of Sequences: 28952 Number of extensions: 146963 Number of successful extensions: 395 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 384 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 395 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 712739520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -