BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_F21 (389 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC144.10c |gwt1|mug59|pig-W|Schizosaccharomyces pombe|chr 1|||... 26 2.4 SPCC757.04 |||transcription factor |Schizosaccharomyces pombe|ch... 24 9.5 >SPAC144.10c |gwt1|mug59|pig-W|Schizosaccharomyces pombe|chr 1|||Manual Length = 459 Score = 25.8 bits (54), Expect = 2.4 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -3 Query: 102 LLNIIVACNFDSLHSSRTSGVCVCKTFLAI 13 +L +V +FD+LHSS G+ + +L I Sbjct: 413 VLTGVVNLSFDTLHSSNAKGLTIMTMYLFI 442 >SPCC757.04 |||transcription factor |Schizosaccharomyces pombe|chr 3|||Manual Length = 684 Score = 23.8 bits (49), Expect = 9.5 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 358 YTHRYVSGFFFPPYLIYSIC 299 Y + + GF+ +LIY+IC Sbjct: 228 YYYNFHDGFYCTEHLIYAIC 247 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,446,568 Number of Sequences: 5004 Number of extensions: 25091 Number of successful extensions: 51 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 128029482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -