BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_F17 (323 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1B2.02c |ugo1||mitochondrial fusion and transport protein Ug... 31 0.043 SPCC4B3.14 |cwf20||complexed with Cdc5 protein Cwf20 |Schizosacc... 31 0.057 SPAC1687.20c |mis6||inner centromere protein Mis6|Schizosaccharo... 26 1.2 SPAC1F3.02c |mkh1||MEK kinase |Schizosaccharomyces pombe|chr 1||... 25 2.1 SPAC11G7.05c |||[acyl-carrier protein] S-malonyltransferase Mct1... 25 2.1 SPAC3A12.15 |vps53||GARP complex subunit Vps53 |Schizosaccharomy... 25 2.1 SPAC12B10.10 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 2.8 SPAC11E3.02c |||C2 domain protein|Schizosaccharomyces pombe|chr ... 25 3.7 SPAC32A11.04c |tif212|tif22, SPAC6B12.17c|translation initiation... 24 4.9 SPBC365.16 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 24 6.5 SPBC365.07c |||TATA element modulatory factor homolog |Schizosac... 23 8.6 SPAC6G10.08 |idp1||isocitrate dehydrogenase Idp1|Schizosaccharom... 23 8.6 >SPAC1B2.02c |ugo1||mitochondrial fusion and transport protein Ugo1|Schizosaccharomyces pombe|chr 1|||Manual Length = 421 Score = 31.1 bits (67), Expect = 0.043 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = -2 Query: 250 SALASPKTAIAGPALIMPFLMLRPIFSIFLKTFHFGSGA--AETVDKARTR 104 SA S AIA P +I P +RP+ S+F+K+ A +D ART+ Sbjct: 194 SATLSGALAIADPNIISPIDSVRPLLSLFIKSITSAISALILSPLDIARTK 244 >SPCC4B3.14 |cwf20||complexed with Cdc5 protein Cwf20 |Schizosaccharomyces pombe|chr 3|||Manual Length = 290 Score = 30.7 bits (66), Expect = 0.057 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -3 Query: 123 STKPEPERTRRKISLRSSSLNIVNFNKRNI 34 STK P+R +R++ L+ SS N FN+ ++ Sbjct: 42 STKKSPKRLKRQVDLQKSSFNDKTFNESDV 71 >SPAC1687.20c |mis6||inner centromere protein Mis6|Schizosaccharomyces pombe|chr 1|||Manual Length = 672 Score = 26.2 bits (55), Expect = 1.2 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 103 LWFWLCRQFRLRLSRNGKSSRKLKK 177 LW WL R LR++ G + L+K Sbjct: 419 LWLWLFRMLNLRIASMGNNHTLLEK 443 >SPAC1F3.02c |mkh1||MEK kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1116 Score = 25.4 bits (53), Expect = 2.1 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +2 Query: 23 NLNSIFRLLKLTIFNDELLKDIFLRVR 103 +LNS+ + LKL FN E +D+F++ R Sbjct: 32 SLNSVLQFLKLYKFNKE-WEDVFIKSR 57 >SPAC11G7.05c |||[acyl-carrier protein] S-malonyltransferase Mct1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 318 Score = 25.4 bits (53), Expect = 2.1 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -2 Query: 250 SALASPKTAIAGPALIMPFLMLRPIFSIFLKTFHFGSG 137 S L P T IA PA++ + L F F K F F G Sbjct: 52 SNLRQPITTIAQPAILACSIALLRAFPPFTKKFRFYVG 89 >SPAC3A12.15 |vps53||GARP complex subunit Vps53 |Schizosaccharomyces pombe|chr 1|||Manual Length = 756 Score = 25.4 bits (53), Expect = 2.1 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -3 Query: 159 RLSISAQAQPKLSTKPEPERTRRKISLRSSSLNIVNFNKR 40 RL + A KL T + ++ ISL ++L ++NF K+ Sbjct: 128 RLQMLVTAYEKLRTLRQNQKFGEAISLMQATLQLLNFFKK 167 >SPAC12B10.10 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 419 Score = 25.0 bits (52), Expect = 2.8 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -3 Query: 156 LSISAQAQPKLSTKPEPERTRRKISLRSSSLNIVNFNKRNIELR 25 LS+ A+ +L P P++TRR +S LN VN+ + R Sbjct: 194 LSLEAREVFQLHHPPSPKQTRRVVS--EGPLNGVNYKQNTTNNR 235 >SPAC11E3.02c |||C2 domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1237 Score = 24.6 bits (51), Expect = 3.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 136 AAETVDKARTRANTKKNILEKFIVEY 59 AAE++ K + T KN+L F+V+Y Sbjct: 17 AAESISKDELYSWTLKNVLILFLVQY 42 >SPAC32A11.04c |tif212|tif22, SPAC6B12.17c|translation initiation factor eIF2 beta subunit|Schizosaccharomyces pombe|chr 1|||Manual Length = 321 Score = 24.2 bits (50), Expect = 4.9 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = -2 Query: 139 GAAETVDKARTRANTKKNILEKFIVEY 59 G++ + K R + +N+L ++IVEY Sbjct: 244 GSSRLIIKGRFQQKQIENVLRRYIVEY 270 >SPBC365.16 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 277 Score = 23.8 bits (49), Expect = 6.5 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -3 Query: 150 ISAQAQPKLSTKPEPERTRRKISL 79 ++ +QP LS KP P T ++I + Sbjct: 1 MALNSQPPLSPKPVPSNTWKRIGI 24 >SPBC365.07c |||TATA element modulatory factor homolog |Schizosaccharomyces pombe|chr 2|||Manual Length = 547 Score = 23.4 bits (48), Expect = 8.6 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = +1 Query: 163 RKLKKWVATSETALSRLDQR 222 ++LKK ++ +ET L RLD++ Sbjct: 67 KQLKKSLSEAETKLKRLDEK 86 >SPAC6G10.08 |idp1||isocitrate dehydrogenase Idp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 418 Score = 23.4 bits (48), Expect = 8.6 Identities = 8/19 (42%), Positives = 15/19 (78%) Frame = +2 Query: 74 LLKDIFLRVRSGSGFVDSF 130 + KD++L +S +G+VD+F Sbjct: 382 MTKDLYLLSKSPNGYVDTF 400 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,082,219 Number of Sequences: 5004 Number of extensions: 17101 Number of successful extensions: 61 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 87815546 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -