BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_F17 (323 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56216| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.1 SB_51135| Best HMM Match : bZIP_1 (HMM E-Value=4.8) 26 8.1 SB_11609| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 >SB_56216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 26.2 bits (55), Expect = 6.1 Identities = 12/52 (23%), Positives = 25/52 (48%) Frame = -2 Query: 232 KTAIAGPALIMPFLMLRPIFSIFLKTFHFGSGAAETVDKARTRANTKKNILE 77 K + P L++P L F ++++ +H+ S A + + AR ++E Sbjct: 32 KKIVIIPFLVLPLPFLTCAFYLYIQRYHYRSTAFLSQESARGSDEAPPTVIE 83 >SB_51135| Best HMM Match : bZIP_1 (HMM E-Value=4.8) Length = 184 Score = 25.8 bits (54), Expect = 8.1 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -2 Query: 250 SALASPKTAIAGPALIMPFLMLRPIFSIFLKTFHFGSGAAE 128 +A P + A PA+I P L R SI T +GSG+ + Sbjct: 124 TAQKPPSVSKAKPAVIEPDLKYRGTLSISPFTSKYGSGSTD 164 >SB_11609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 221 Score = 25.8 bits (54), Expect = 8.1 Identities = 15/27 (55%), Positives = 17/27 (62%), Gaps = 2/27 (7%) Frame = +3 Query: 180 GRNIRNGIIKAGPAIAVLGEAK--ALG 254 GR R+ IK GP + VLG AK ALG Sbjct: 143 GRGDRHRKIKLGPIVRVLGPAKTAALG 169 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,666,432 Number of Sequences: 59808 Number of extensions: 117309 Number of successful extensions: 299 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 290 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 299 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 438034835 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -