BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_F16 (639 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6866| Best HMM Match : Peptidase_C48 (HMM E-Value=0.045) 32 0.45 SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.60 SB_29832| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_24208| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_17069| Best HMM Match : Transposase_8 (HMM E-Value=7.7) 29 4.2 SB_30304| Best HMM Match : fn3 (HMM E-Value=1.5e-32) 28 5.6 SB_1307| Best HMM Match : Filament (HMM E-Value=0.13) 28 5.6 SB_46909| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.00039) 27 9.7 >SB_6866| Best HMM Match : Peptidase_C48 (HMM E-Value=0.045) Length = 1050 Score = 31.9 bits (69), Expect = 0.45 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = +1 Query: 433 ATRNMPTISHLPSTQHCWWWSR--IYVQGQDRCISE 534 +TR+ PT SH+PST+H R + DRCISE Sbjct: 117 STRHAPTASHVPSTRHAPRKQRRMATLSLSDRCISE 152 >SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1778 Score = 31.5 bits (68), Expect = 0.60 Identities = 31/114 (27%), Positives = 44/114 (38%), Gaps = 2/114 (1%) Frame = +1 Query: 127 TSSRVRRQAGELTINSDGTSGAMVKVPITGNENHKLSALGSVDLTNQIKLGAATAGLVY- 303 T V+ + + TIN + +K + GN + L A S N K G + Y Sbjct: 658 TIDSVKEEDSKATINCIRNNNTYIKQSVEGNNSFSLDASSS---ENVRKEGDKDVVISYS 714 Query: 304 DNVNRHGATLTNTH-IPGIGDKLSVAGKVNLFHNNDHDLSAKAFATRNMPTISH 462 DN+N A T+ IPG K KVN + + A + T SH Sbjct: 715 DNMNNSKAANTDQFGIPGSDSKTGSDSKVNAKASGQTSNAMDASNSDTRETSSH 768 >SB_29832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1293 Score = 30.3 bits (65), Expect = 1.4 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = -2 Query: 275 NLIWLVRSTEPRALSL*FSFPVIGTLTIAPEVPSELIVS 159 NL + S PR LS FP +G+ TI P S +IVS Sbjct: 1187 NLDGVDSSVMPRELSQVLRFPFLGSFTIRPLAQSSVIVS 1225 >SB_24208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 28.7 bits (61), Expect = 4.2 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -3 Query: 475 GLMVNGKWWAYFWSRTPSRINH 410 G N +WW Y + RTP H Sbjct: 9 GRRTNSEWWMYLYHRTPEGATH 30 >SB_17069| Best HMM Match : Transposase_8 (HMM E-Value=7.7) Length = 733 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -3 Query: 505 HIFETTTNSVGLMVNGKWWAYFWSRTPSRINHG 407 H TT+ + L+ N W FW+ P +HG Sbjct: 155 HTLNTTSVTTWLLSNTNWMRKFWTSDPKFRSHG 187 >SB_30304| Best HMM Match : fn3 (HMM E-Value=1.5e-32) Length = 808 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = +1 Query: 352 GIGDKLSVAGKVNLFHNNDHDLSAKAFAT 438 G+ D L++ G VN+FHN DL++++ +T Sbjct: 612 GLSD-LTIDGHVNIFHNQGTDLNSQSGST 639 >SB_1307| Best HMM Match : Filament (HMM E-Value=0.13) Length = 916 Score = 28.3 bits (60), Expect = 5.6 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 5/85 (5%) Frame = +1 Query: 166 INSDGTSGAMVKVPITGN-ENHKLSALGSVD----LTNQIKLGAATAGLVYDNVNRHGAT 330 I+SD + ++V +GN +N LS + S N I +T+ L + N HG+T Sbjct: 632 ISSDYHGDSSLRVHSSGNHDNTSLSGVSSGSHGNFSGNGIYRSRSTSNLSHGN---HGST 688 Query: 331 LTNTHIPGIGDKLSVAGKVNLFHNN 405 T GI L+ N FH N Sbjct: 689 TTRNMSSGIQSNLAFGRLSNGFHEN 713 >SB_46909| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.00039) Length = 685 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -2 Query: 266 WLVRSTEPRALSL*FSFPVIGTLTIAPEVPSELIV 162 W+V ++EP LS +I T +I P P I+ Sbjct: 472 WVVETSEPLQLSTTIMISIITTTSILPSFPPTAII 506 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,034,588 Number of Sequences: 59808 Number of extensions: 424006 Number of successful extensions: 937 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 879 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 937 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -