BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_F15 (628 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 31 0.63 At1g13980.1 68414.m01647 pattern formation protein (EMB30) (GNOM... 29 2.5 At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa... 29 3.3 At3g27925.1 68416.m03484 DegP protease, putative SP:022609; almo... 29 3.3 At2g23300.1 68415.m02781 leucine-rich repeat transmembrane prote... 28 4.4 At2g26890.1 68415.m03226 DNAJ heat shock N-terminal domain-conta... 28 5.8 At5g18550.1 68418.m02193 zinc finger (CCCH-type) family protein ... 27 7.7 At3g59420.1 68416.m06627 receptor protein kinase, putative (ACR4... 27 7.7 At1g71320.1 68414.m08232 S locus F-box-related / SLF-related con... 27 7.7 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 27 7.7 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 31.1 bits (67), Expect = 0.63 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +3 Query: 285 RRCNRWSGTG*CKRPRSKSHGYTHPRVRRQGDSCRQSESLPQRXP 419 R C GTG R RSKS T PR RR R+S S R P Sbjct: 112 RECRNRGGTG---RRRSKSRSRTPPRYRRSPSYGRRSYSPRARSP 153 >At1g13980.1 68414.m01647 pattern formation protein (EMB30) (GNOM) identical to SP|Q42510; contains Pfam profile PF01369: Sec7 domain Length = 1451 Score = 29.1 bits (62), Expect = 2.5 Identities = 22/63 (34%), Positives = 32/63 (50%) Frame = +1 Query: 58 GVQSRYLIVSEPVYYIQHYEEPELLTSSRVRRDAHGALTLNSDGTSGAGVKVPFAGNDKN 237 GV S Y IVS+PV E ++ S + A GA +L DG G G + P + D + Sbjct: 249 GVDSDYAIVSKPVEDGNANSEYDVENS--MATFATGAQSLMDDGPVGPGSRKPASPYDLH 306 Query: 238 IVS 246 I++ Sbjct: 307 IMT 309 >At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch domain-containing protein / RNA recognition motif (RRM)-containing protein KIAA0122 gene , Homo sapiens, EMBL:HSDKG02; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF01585: G-patch domain, weak hit to PF00641: Zn-finger in Ran binding protein and others Length = 1105 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +3 Query: 321 KRPRSKSHGYTHPRVRRQGDSCRQSESLPQRXPRHHSEGF 440 + PR +SHG ++ +GD +SE + RH+ + F Sbjct: 253 RSPRGRSHGRSYREDSYEGDHWNESERRREYEDRHNQDHF 292 >At3g27925.1 68416.m03484 DegP protease, putative SP:022609; almost identical to DegP protease precursor GB:AF028842 from [Arabidopsis thaliana] (J. Biol. Chem. 273 (12), 7094-7098 (1998)) Length = 439 Score = 28.7 bits (61), Expect = 3.3 Identities = 23/80 (28%), Positives = 40/80 (50%) Frame = -3 Query: 356 MCVSVRLTPWPFTLSSATPAVAAPSFCLLVKSKEPIALTIFLSLPAKGTLTPAPEVPSEL 177 +C SV L+ F+L +A+PAV + S +V + + + ++ TP+ + L Sbjct: 83 LCTSVALS---FSLFAASPAVESAS-AFVVSTPKKLQTDELATVRLFQENTPSVVYITNL 138 Query: 176 SVRAPCASLRTLELVNSSGS 117 +VR +L LE+ SGS Sbjct: 139 AVRQDAFTLDVLEVPQGSGS 158 >At2g23300.1 68415.m02781 leucine-rich repeat transmembrane protein kinase, putative Length = 773 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -3 Query: 383 AVTLSPNPGMCVSVRLTPWPFTLSSAT--PAVAAPSFCLLVKS 261 +++ S NPG+C P P S AT P + P+ + KS Sbjct: 268 SISFSGNPGLCGGPTRNPCPIPSSPATVSPPTSTPALAAIPKS 310 >At2g26890.1 68415.m03226 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226: DnaJ domain Length = 2554 Score = 27.9 bits (59), Expect = 5.8 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = -3 Query: 392 LPAAVTLSPNPGMCVSVRLTPWPFTLSSATPAVAAPSFCLLVKSK 258 L A+ LS G+C LTP+ T + A+ P L+K + Sbjct: 1804 LQASQALSRLTGLCADESLTPYNATAADVLKALLTPKLASLLKDE 1848 >At5g18550.1 68418.m02193 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 456 Score = 27.5 bits (58), Expect = 7.7 Identities = 13/51 (25%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = -3 Query: 386 AAVTLSPNPGMCVSVRLTPWPFTLSSATPAVAAPSFCLLVKSK--EPIALT 240 ++++ SP+P + + P+P +L + P+ ++ L+ S EPI T Sbjct: 366 SSLSYSPSPSSLTDMPVAPYPSSLGTLAPSSSSDQCTELISSSSIEPITTT 416 >At3g59420.1 68416.m06627 receptor protein kinase, putative (ACR4) identical to putative receptor protein kinase ACR4 [Arabidopsis thaliana] GI:20302590; contains protein kinase domain, Pfam:PF00069 Length = 895 Score = 27.5 bits (58), Expect = 7.7 Identities = 17/66 (25%), Positives = 28/66 (42%) Frame = -3 Query: 506 SIPPPTVLKLGTLAISGIFLVAKAFAVMSWXSLWKRFTLPAAVTLSPNPGMCVSVRLTPW 327 S P PT + LA +G + S + PA++ L+ +PG+C+ P Sbjct: 292 STPAPTGIGFYDLA-AGNYFTCGVLTGTSMSPVCWGLGFPASIPLAVSPGLCIDTPCPPG 350 Query: 326 PFTLSS 309 LS+ Sbjct: 351 THELSN 356 >At1g71320.1 68414.m08232 S locus F-box-related / SLF-related contains F-box domain Pfam:PF00646; contains TIGRFAM TIGR01640: F-box protein interaction domain; similar to S locus F-box (SLF)-S2-like protein (GI:13161528) [Antirrhinum hispanicum] Length = 392 Score = 27.5 bits (58), Expect = 7.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 Query: 356 MCVSVRLTPWPFTLSSATPAVA 291 M +S WPFTLS TPA+A Sbjct: 144 MKLSPEFMQWPFTLSYLTPAMA 165 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 27.5 bits (58), Expect = 7.7 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -3 Query: 395 TLPAAVTLSPNPGMCVSVRLTPWPFTLSSATPAVAAPS 282 +LP + N + S LTP FT ++A PA P+ Sbjct: 342 SLPPGQYMPGNAALSASTPLTPGQFTTANAPPAPPGPA 379 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.317 0.135 0.391 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,790,106 Number of Sequences: 28952 Number of extensions: 290480 Number of successful extensions: 856 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 835 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 855 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -