Samia BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0002_F14
         (651 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g24930.1 68415.m02981 Ulp1 protease family protein contains P...    30   1.5  

>At2g24930.1 68415.m02981 Ulp1 protease family protein contains Pfam
           profile PF02902: Ulp1 protease family, C-terminal
           catalytic domain
          Length = 926

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 2/30 (6%)
 Frame = -1

Query: 93  IEGWFTAK*DEDYCQW--GKKKSPFKGANY 10
           ++ WFT+   +DY QW    K+  FKG+ Y
Sbjct: 731 LDPWFTSMWTKDYAQWKMNPKRVSFKGSTY 760


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,791,411
Number of Sequences: 28952
Number of extensions: 231051
Number of successful extensions: 461
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 459
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 461
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1354097952
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)