BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_F12 (608 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC031945-1|AAH31945.1| 82|Homo sapiens chromosome 2 open readi... 29 9.7 AC016757-2|AAY24334.1| 82|Homo sapiens unknown protein. 29 9.7 >BC031945-1|AAH31945.1| 82|Homo sapiens chromosome 2 open reading frame 19 protein. Length = 82 Score = 29.5 bits (63), Expect = 9.7 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -2 Query: 565 LPNKSRQNRSSRSGDYPLQTDKYL*NWFWYR 473 L + R++RSSR+G PLQ W W+R Sbjct: 18 LSKELRRSRSSRNGGLPLQEQPMGQKWGWHR 48 >AC016757-2|AAY24334.1| 82|Homo sapiens unknown protein. Length = 82 Score = 29.5 bits (63), Expect = 9.7 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -2 Query: 565 LPNKSRQNRSSRSGDYPLQTDKYL*NWFWYR 473 L + R++RSSR+G PLQ W W+R Sbjct: 18 LSKELRRSRSSRNGGLPLQEQPMGQKWGWHR 48 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,415,333 Number of Sequences: 237096 Number of extensions: 1479158 Number of successful extensions: 1485 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1485 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6466646650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -