BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_F10 (440 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28239| Best HMM Match : Integrin_alpha (HMM E-Value=0.47) 27 5.2 SB_38733| Best HMM Match : Integrin_alpha (HMM E-Value=0.47) 27 5.2 SB_26202| Best HMM Match : Pkinase (HMM E-Value=0.0017) 27 6.9 SB_5192| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) 27 9.1 >SB_28239| Best HMM Match : Integrin_alpha (HMM E-Value=0.47) Length = 197 Score = 27.5 bits (58), Expect = 5.2 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +1 Query: 307 AHPWYIR*RCKK*QCLHFLSVCLFRVISGTV 399 A P++ + KK + LHFLS+ LF+V T+ Sbjct: 102 ARPFFFISKDKKEEVLHFLSIRLFKVFCVTL 132 >SB_38733| Best HMM Match : Integrin_alpha (HMM E-Value=0.47) Length = 197 Score = 27.5 bits (58), Expect = 5.2 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +1 Query: 307 AHPWYIR*RCKK*QCLHFLSVCLFRVISGTV 399 A P++ + KK + LHFLS+ LF+V T+ Sbjct: 102 ARPFFFISKDKKEEVLHFLSIRLFKVFCVTL 132 >SB_26202| Best HMM Match : Pkinase (HMM E-Value=0.0017) Length = 401 Score = 27.1 bits (57), Expect = 6.9 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 19 HGTPVCRVTHFTKH 60 HGTPVC V H +H Sbjct: 15 HGTPVCTVVHAIRH 28 >SB_5192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4865 Score = 26.6 bits (56), Expect = 9.1 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = -1 Query: 434 PVNTKCPVXIGST--VPEITRNKQTDKKCKHCH 342 P TKC V + PE T + DKKC+ H Sbjct: 1528 PEFTKCRVTVDELFLAPEYTNSFSIDKKCESLH 1560 >SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 293 Score = 26.6 bits (56), Expect = 9.1 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +3 Query: 276 RAACGSRAAGCTPLVYKIAMQKMTMFTFFVCLFVPCNLRNG*TDXDGT 419 R ACGSR C P+ K M + + V PC LR+ +GT Sbjct: 159 RGACGSRPDKCAPICNK--MYQPVCGSDNVTYSNPCMLRSATCKSNGT 204 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,666,648 Number of Sequences: 59808 Number of extensions: 312039 Number of successful extensions: 616 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 579 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 616 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 859323430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -