BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_F10 (440 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor prot... 25 0.37 S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor prot... 25 0.37 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 21 4.5 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 21 7.9 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 21 7.9 DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. 21 7.9 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 21 7.9 >S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor protein. Length = 169 Score = 25.0 bits (52), Expect = 0.37 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +3 Query: 306 CTPLVYKIAMQKMTMFTFFVCLFVPCNLRNG*TDXDGTFCI 428 C PL+Y +AM + V +V L N T FC+ Sbjct: 7 CNPLLYSVAMSQRLCIQLVVGPYV-IGLMNTMTHTTNAFCL 46 >S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor protein. Length = 168 Score = 25.0 bits (52), Expect = 0.37 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +3 Query: 306 CTPLVYKIAMQKMTMFTFFVCLFVPCNLRNG*TDXDGTFCI 428 C PL+Y +AM + V +V L N T FC+ Sbjct: 6 CNPLLYSVAMSQRLCIQLVVGPYV-IGLMNTMTHTTNAFCL 45 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 262 CGSR*MYQSSLFIFVLIIY 206 CGS Y S +F + L+IY Sbjct: 320 CGSAIAYVSDVFRYGLLIY 338 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 20.6 bits (41), Expect = 7.9 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +3 Query: 276 RAACGSRAAGCTPLVYKIAMQK 341 R GSRAA T VY+ ++ Sbjct: 293 RRTTGSRAAATTTTVYQFIEER 314 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 20.6 bits (41), Expect = 7.9 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +3 Query: 276 RAACGSRAAGCTPLVYKIAMQK 341 R GSRAA T VY+ ++ Sbjct: 293 RRTTGSRAAATTTTVYQFIEER 314 >DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. Length = 150 Score = 20.6 bits (41), Expect = 7.9 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -1 Query: 59 CFVKCVTRHTGV 24 CF+ C+ + TGV Sbjct: 70 CFLACIWQQTGV 81 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 20.6 bits (41), Expect = 7.9 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +3 Query: 276 RAACGSRAAGCTPLVYKIAMQK 341 R GSRAA T VY+ ++ Sbjct: 293 RRTTGSRAAATTTTVYQFIEER 314 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,441 Number of Sequences: 438 Number of extensions: 2778 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11450997 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -