BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_F10 (440 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g01430.1 68414.m00058 expressed protein similar to hypothetic... 29 1.8 At3g15380.1 68416.m01950 choline transporter-related contains we... 28 2.4 At4g03470.1 68417.m00474 ankyrin repeat family protein contains ... 27 5.6 At4g22120.1 68417.m03198 early-responsive to dehydration protein... 26 9.8 At4g15500.1 68417.m02368 UDP-glucoronosyl/UDP-glucosyl transfera... 26 9.8 At4g05040.2 68417.m00741 ankyrin repeat family protein contains ... 26 9.8 At4g05040.1 68417.m00740 ankyrin repeat family protein contains ... 26 9.8 At3g21620.1 68416.m02727 early-responsive to dehydration protein... 26 9.8 At1g77610.1 68414.m09036 glucose-6-phosphate/phosphate transloca... 26 9.8 >At1g01430.1 68414.m00058 expressed protein similar to hypothetical protein GB:CAB80917 GI:7267605 from [Arabidopsis thaliana] Length = 456 Score = 28.7 bits (61), Expect = 1.8 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -1 Query: 440 SYPVNTKCPVXIGSTVPEITRNKQTDKKCKH 348 S V+TKC + IG+ VP+ + T+ C+H Sbjct: 92 SQNVSTKCDIFIGNWVPDPSGPIYTNVSCRH 122 >At3g15380.1 68416.m01950 choline transporter-related contains weak similarity to CD92 protein [Homo sapiens] gi|16945323|emb|CAC82175 Length = 700 Score = 28.3 bits (60), Expect = 2.4 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +2 Query: 281 RMWLTSRRLHTPGI*DSDAKNDNVYIFCLSVCSV*SPERLN 403 R WL +++ G+ D + K N CL C S + LN Sbjct: 89 RYWLNPNQVYESGLKDGELKLANARTICLLDCPAPSDDTLN 129 >At4g03470.1 68417.m00474 ankyrin repeat family protein contains ankyrin repeats, Pfam domain PF00023 Length = 683 Score = 27.1 bits (57), Expect = 5.6 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 399 NRSGDYTEQTDRQKM*TLSFFASLSYIPGVCNL 301 N ++ D + LSF AS+ Y GVCNL Sbjct: 291 NEYPSLVDERDEEGRTCLSFGASIGYHKGVCNL 323 >At4g22120.1 68417.m03198 early-responsive to dehydration protein-related / ERD protein-related similar to ERD4 protein (early-responsive to dehydration stress) [Arabidopsis thaliana] GI:15375406; contains Pfam profile PF02714: Domain of unknown function DUF221 Length = 771 Score = 26.2 bits (55), Expect = 9.8 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +3 Query: 162 FHICCQGRTDRFFFKYIINTKIKRELWYIYREPQIILQ 275 FH C+GR + F +Y + + ++ REP + L+ Sbjct: 668 FHHFCKGRYEPAFIRYPLQEAMMKDTLETAREPNLNLK 705 >At4g15500.1 68417.m02368 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 475 Score = 26.2 bits (55), Expect = 9.8 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -1 Query: 146 CNKINFRPSYE*IASSKTARTNIKGGVIQCFVKCV 42 C ++NF P +KT R++IKG + + C+ Sbjct: 233 CPQVNFNPIGPLFTMAKTIRSDIKGDISKPDSDCI 267 >At4g05040.2 68417.m00741 ankyrin repeat family protein contains ankyrin repeats, Pfam domain PF00023 Length = 572 Score = 26.2 bits (55), Expect = 9.8 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -3 Query: 378 EQTDRQKM*TLSFFASLSYIPGVCNL 301 ++ D + LSF AS+ + GVCNL Sbjct: 301 DERDEEGRTCLSFAASIGFYKGVCNL 326 >At4g05040.1 68417.m00740 ankyrin repeat family protein contains ankyrin repeats, Pfam domain PF00023 Length = 572 Score = 26.2 bits (55), Expect = 9.8 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -3 Query: 378 EQTDRQKM*TLSFFASLSYIPGVCNL 301 ++ D + LSF AS+ + GVCNL Sbjct: 301 DERDEEGRTCLSFAASIGFYKGVCNL 326 >At3g21620.1 68416.m02727 early-responsive to dehydration protein-related / ERD protein-related similar to ERD4 protein (early-responsive to dehydration stress) [Arabidopsis thaliana] GI:15375406; contains Pfam profile PF02714: Domain of unknown function DUF221 Length = 756 Score = 26.2 bits (55), Expect = 9.8 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = +3 Query: 126 TEINFVTTIQLV-FHICCQGRTDRFFFKYIINTKIKRELWYIYREPQIILQ 275 T + F+ + + FH CQGR F Y + + ++ REP + L+ Sbjct: 652 TPLLFILPVLTIGFHKFCQGRYQPIFVTYPLQDAMVKDTLERMREPNLNLK 702 >At1g77610.1 68414.m09036 glucose-6-phosphate/phosphate translocator-related similar to glucose-6-phosphate/phosphate-translocators from [Mesembryanthemum crystallinum] GI:9295277, [Solanum tuberosum] GI:2997593, [Pisum sativum] GI:2997591; contains Pfam profile PF00892: Integral membrane protein Length = 336 Score = 26.2 bits (55), Expect = 9.8 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +3 Query: 240 WYIYREPQIILQRAACGSRAAGCT 311 W I+R P + CG GCT Sbjct: 271 WLIFRNPISYMNAVGCGITLVGCT 294 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,018,034 Number of Sequences: 28952 Number of extensions: 202155 Number of successful extensions: 395 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 395 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 702840360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -