BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_F02 (570 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g25510.1 68418.m03035 serine/threonine protein phosphatase 2A... 29 1.7 At4g22300.1 68417.m03225 phospholipase/carboxylesterase family p... 27 6.7 At4g21440.1 68417.m03099 myb family transcription factor (MYB102... 27 8.8 At3g50080.1 68416.m05475 F-box family protein (FBL16) contains s... 27 8.8 At1g13460.2 68414.m01575 serine/threonine protein phosphatase 2A... 27 8.8 At1g13460.1 68414.m01574 serine/threonine protein phosphatase 2A... 27 8.8 >At5g25510.1 68418.m03035 serine/threonine protein phosphatase 2A (PP2A) regulatory subunit B', putative similar to SWISS-PROT:Q28653 serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, delta isoform (PP2A, B subunit, B' delta isoform, PP2A, B subunit, B56 delta isoform, PP2A, B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta isoform, PP2A, B subunit, B'-gamma) [Oryctolagus cuniculus]; contains Pfam domain, PF01603: Protein phosphatase 2A regulatory B subunit (B56 family) Length = 500 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = -3 Query: 487 RHRQCLKFGT*GIFGRFLVANALALKSWSSLWKRF 383 R R+CLK ++G+F+V KS S+++ RF Sbjct: 218 RERECLKTILHRVYGKFMVHRPFVRKSMSNIFYRF 252 >At4g22300.1 68417.m03225 phospholipase/carboxylesterase family protein similar to acyl-protein thioesterase-1 [Homo sapiens] GI:9965372; contains Pfam profile PF02230: Phospholipase/Carboxylesterase family Length = 471 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -1 Query: 147 LAGAPWSWPTAPADPHIVQCSNQALQRA 64 L+ A W +P+AP +P V C+N A+ R+ Sbjct: 31 LSNASWLFPSAPFNP--VTCNNGAVMRS 56 >At4g21440.1 68417.m03099 myb family transcription factor (MYB102) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 350 Score = 27.1 bits (57), Expect = 8.8 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +1 Query: 13 PSYSSYQFFWSASTAGTCSLKSLVTTLNNMRISRSSGPT 129 PSYS F ++ S T S TTLN+ I+ SS T Sbjct: 285 PSYSDQSFNFANSVLNTPSSSPSPTTLNSSYINSSSCST 323 >At3g50080.1 68416.m05475 F-box family protein (FBL16) contains similarity to SKP1 interacting partner 2 GI:10716949 from [Arabidopsis thaliana]; contains Pfam profile: PF00646 F-box domain Length = 522 Score = 27.1 bits (57), Expect = 8.8 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -1 Query: 561 ITIKDIGVSGVRRCTNLVLEHVV 493 + + DIG+ G+ +C+NL H+V Sbjct: 267 LQVTDIGLFGISKCSNLETLHIV 289 >At1g13460.2 68414.m01575 serine/threonine protein phosphatase 2A (PP2A) regulatory subunit B', putative similar to SWISS-PROT:Q28653 serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, delta isoform (PP2A, B subunit, B' delta isoform, PP2A, B subunit, B56 delta isoform, PP2A, B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta isoform, PP2A, B subunit, B'-gamma) [Oryctolagus cuniculus]; contains Pfam domain, PF01603: Protein phosphatase 2A regulatory B subunit (B56 family) Length = 492 Score = 27.1 bits (57), Expect = 8.8 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 487 RHRQCLKFGT*GIFGRFLVANALALKSWSSLWKRF 383 R R CLK I+G+F+V KS ++++ RF Sbjct: 224 RERDCLKTVLHRIYGKFMVHRPFIRKSINNIFYRF 258 >At1g13460.1 68414.m01574 serine/threonine protein phosphatase 2A (PP2A) regulatory subunit B', putative similar to SWISS-PROT:Q28653 serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, delta isoform (PP2A, B subunit, B' delta isoform, PP2A, B subunit, B56 delta isoform, PP2A, B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta isoform, PP2A, B subunit, B'-gamma) [Oryctolagus cuniculus]; contains Pfam domain, PF01603: Protein phosphatase 2A regulatory B subunit (B56 family) Length = 492 Score = 27.1 bits (57), Expect = 8.8 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 487 RHRQCLKFGT*GIFGRFLVANALALKSWSSLWKRF 383 R R CLK I+G+F+V KS ++++ RF Sbjct: 224 RERDCLKTVLHRIYGKFMVHRPFIRKSINNIFYRF 258 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,776,351 Number of Sequences: 28952 Number of extensions: 263187 Number of successful extensions: 680 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 659 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 680 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1102220672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -