BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_F01 (578 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 24 3.1 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 24 4.1 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 24.2 bits (50), Expect = 3.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 573 IKVRLFCFY*RNKC 532 +K+ FCFY R KC Sbjct: 1 LKIETFCFYFRYKC 14 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.8 bits (49), Expect = 4.1 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = -1 Query: 278 NSASNGCGFTLIGPVVFE-FTSDKETNFAYIYIEDRLDENVQFARNDYDKD 129 N + C TL P+ E T D+E N D D +F+ ND D+D Sbjct: 702 NECATNC--TLFVPIPVEKVTIDEERNDNKCTFFDEDDCRFEFSYNDSDQD 750 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 576,770 Number of Sequences: 2352 Number of extensions: 10275 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55086417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -