BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_E24 (577 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 25 0.71 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 23 1.6 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 23 1.6 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 2.2 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 22 3.8 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 22 3.8 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 22 3.8 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 22 3.8 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 22 3.8 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 22 3.8 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 22 3.8 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 22 3.8 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 22 5.0 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 22 5.0 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 22 5.0 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 22 5.0 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 21 6.6 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 6.6 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 21 6.6 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 21 6.6 L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 21 8.7 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 8.7 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 24.6 bits (51), Expect = 0.71 Identities = 15/65 (23%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +2 Query: 137 NQYLTHQDPNKVTFQEQF-LDISKLPVVMGDLTSGPVPNNSWLATKPIEVTNTHNTNYNK 313 N Y +++ +K +++ + S+ P ++ L++ + NN+ N +N NYN Sbjct: 287 NSYRKYRETSKERSRDRTERERSREPKIISSLSNKTIHNNNNYKYN-YNNNNYNNNNYNN 345 Query: 314 MYTHN 328 Y +N Sbjct: 346 NYNNN 350 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.4 bits (48), Expect = 1.6 Identities = 15/64 (23%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Frame = +2 Query: 140 QYLTHQDPNKVTFQEQF-LDISKLPVVMGDLTSGPVPNNSWLATKPIEVTNTHNTNYNKM 316 +Y +++ +K Q++ + SK P ++ L+ N++ + N +N NYN Sbjct: 55 EYRKYRETSKERSQDRTERETSKEPKIISSLS------NNYKYSNYNNYNNNYNNNYNNN 108 Query: 317 YTHN 328 Y +N Sbjct: 109 YNNN 112 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.4 bits (48), Expect = 1.6 Identities = 15/64 (23%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Frame = +2 Query: 140 QYLTHQDPNKVTFQEQF-LDISKLPVVMGDLTSGPVPNNSWLATKPIEVTNTHNTNYNKM 316 +Y +++ +K Q++ + SK P ++ L+ N++ + N +N NYN Sbjct: 55 EYRKYRETSKERSQDRTERETSKEPKIISSLS------NNYKYSNYNNYNNNYNNNYNNN 108 Query: 317 YTHN 328 Y +N Sbjct: 109 YNNN 112 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 53 VNSSYQTGFYNTTPVDPLSPNFEGFTP 133 VNS Y +G TP P P G P Sbjct: 380 VNSMYASGAQFATPCTPSPPRGPGGVP 406 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 Query: 287 NTHNTNYNKMYTHNTL 334 N +NTNY K+ +N + Sbjct: 99 NNYNTNYKKLQYYNII 114 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 Query: 287 NTHNTNYNKMYTHNTL 334 N +NTNY K+ +N + Sbjct: 99 NNYNTNYKKLQYYNII 114 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 Query: 287 NTHNTNYNKMYTHNTL 334 N +NTNY K+ +N + Sbjct: 99 NNYNTNYKKLQYYNII 114 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 Query: 287 NTHNTNYNKMYTHNTL 334 N +NTNY K+ +N + Sbjct: 99 NNYNTNYKKLQYYNII 114 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 Query: 287 NTHNTNYNKMYTHNTL 334 N +NTNY K+ +N + Sbjct: 99 NNYNTNYKKLQYYNII 114 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 Query: 287 NTHNTNYNKMYTHNTL 334 N +NTNY K+ +N + Sbjct: 99 NNYNTNYKKLQYYNII 114 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 Query: 287 NTHNTNYNKMYTHNTL 334 N +NTNY K+ +N + Sbjct: 103 NNYNTNYKKLQYYNII 118 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 Query: 287 NTHNTNYNKMYTHNTL 334 N +NTNY K+ +N + Sbjct: 99 NNYNTNYKKLQYYNII 114 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 5.0 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 287 NTHNTNYNKMYTHN 328 N +N NY K+Y +N Sbjct: 90 NYNNNNYKKLYCNN 103 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 5.0 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 287 NTHNTNYNKMYTHN 328 N +N NY K+Y +N Sbjct: 90 NYNNNNYKKLYCNN 103 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 5.0 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 287 NTHNTNYNKMYTHN 328 N +N NY K+Y +N Sbjct: 90 NYNNNNYKKLYCNN 103 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.8 bits (44), Expect = 5.0 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = +2 Query: 200 SKLPVVMGDLTSGPVPNNSWLATKPIEVTNTHNTNYN 310 S+ P ++ L++ + NN+ N +N NYN Sbjct: 76 SREPKIISSLSNKTIHNNNNYNNNNYNNYNYNNNNYN 112 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 21.4 bits (43), Expect = 6.6 Identities = 7/26 (26%), Positives = 17/26 (65%) Frame = +2 Query: 350 DDSFDTKFVSVTPREVESNDIIISEY 427 D+S+ +KF ++ E+ +D +++ Y Sbjct: 22 DESYTSKFDNINVDEILHSDRLLNNY 47 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 6.6 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +2 Query: 293 HNTNYNKMYTHNTL 334 HN NYNK +N + Sbjct: 324 HNNNYNKKLYYNII 337 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 21.4 bits (43), Expect = 6.6 Identities = 7/26 (26%), Positives = 17/26 (65%) Frame = +2 Query: 350 DDSFDTKFVSVTPREVESNDIIISEY 427 D+S+ +KF ++ E+ +D +++ Y Sbjct: 22 DESYTSKFDNINVDEILHSDRLLNNY 47 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 21.4 bits (43), Expect = 6.6 Identities = 7/26 (26%), Positives = 17/26 (65%) Frame = +2 Query: 350 DDSFDTKFVSVTPREVESNDIIISEY 427 D+S+ +KF ++ E+ +D +++ Y Sbjct: 22 DESYTSKFDNINVDEILHSDRLLNNY 47 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 21.0 bits (42), Expect = 8.7 Identities = 6/22 (27%), Positives = 13/22 (59%) Frame = -3 Query: 359 RSHLDQ*RAKCYACTFCCSWCY 294 +SH + + +C CT+ +C+ Sbjct: 37 KSHSNVYQYRCANCTYATKYCH 58 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.0 bits (42), Expect = 8.7 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +2 Query: 224 DLTSGPVPNNSWLATKPIEVTNTHNTNYNK 313 D+T P+PN S L + VT + ++ K Sbjct: 129 DITKRPLPNESQLIKRHPIVTIMGHVDHGK 158 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,206 Number of Sequences: 438 Number of extensions: 3908 Number of successful extensions: 30 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16626408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -