BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_E20 (654 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 1.9 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 1.9 EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. 23 2.6 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 23 2.6 AB083209-1|BAC54133.1| 87|Apis mellifera hypothetical protein ... 22 6.0 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -3 Query: 142 FFGTVIMIGALMLTYNYTTLNHNI--TALLPCYI 47 FF + +GAL+ +Y N+N+ AL+ C + Sbjct: 288 FFSYALGLGALVALGSYNKFNNNVYKDALIVCTV 321 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -3 Query: 142 FFGTVIMIGALMLTYNYTTLNHNI--TALLPCYI 47 FF + +GAL+ +Y N+N+ AL+ C + Sbjct: 341 FFSYALGLGALVALGSYNKFNNNVYKDALIVCTV 374 >EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. Length = 200 Score = 23.0 bits (47), Expect = 2.6 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -1 Query: 303 LSSCHATFAPLRDSSTFFFAFFLPMINDLNGVF 205 L S +AP ++ T F F P+I D +G F Sbjct: 44 LDSGVGIYAPDAEAYTLFADLFDPIIEDYHGGF 76 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 23.0 bits (47), Expect = 2.6 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -1 Query: 303 LSSCHATFAPLRDSSTFFFAFFLPMINDLNGVF 205 L S +AP ++ T F F P+I D +G F Sbjct: 60 LDSGVGIYAPDAEAYTLFADLFDPIIEDYHGGF 92 >AB083209-1|BAC54133.1| 87|Apis mellifera hypothetical protein protein. Length = 87 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -1 Query: 510 PPGALPSAEE*TLLVFGPPGRFAPPPHCAALR 415 PPG P+ E+ + ++ G G PP+ A R Sbjct: 52 PPGPPPNNEDSSGVIVGASGYGFVPPNQAFYR 83 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,780 Number of Sequences: 438 Number of extensions: 3698 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -