BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_E18 (454 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 2.3 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 3.1 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 21 7.1 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 21 7.1 AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 20 9.4 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 22.2 bits (45), Expect = 2.3 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = -2 Query: 285 NEDIYFPPRGERVVVSLGWIIG 220 NE+I P G ++++ +G +IG Sbjct: 642 NENISMPYIGYQIILMIGTVIG 663 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.8 bits (44), Expect = 3.1 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = +1 Query: 121 IANPDPFFSQPSNGPSGNYEPISTGPAFVDFN 216 I NP P + PSN + S P D N Sbjct: 416 IINPQPQITSPSNTNTSTSSTNSNKPNSSDLN 447 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 20.6 bits (41), Expect = 7.1 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = +1 Query: 205 VDFNHPNYPPKRY 243 +D NHP + K Y Sbjct: 217 LDMNHPGFADKEY 229 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 20.6 bits (41), Expect = 7.1 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 151 PSNGPSGNYEPIST 192 P GPSG Y P T Sbjct: 407 PHAGPSGAYSPDGT 420 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 20.2 bits (40), Expect = 9.4 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = -2 Query: 321 SSFLLVLKSLIFNED 277 S+ ++L SLIFN++ Sbjct: 30 SAVTIILSSLIFNQE 44 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,412 Number of Sequences: 336 Number of extensions: 2005 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10301074 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -