BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_E18 (454 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55470| Best HMM Match : Nucleoplasmin (HMM E-Value=4.8) 27 7.3 SB_44915| Best HMM Match : VWA (HMM E-Value=0) 27 7.3 SB_13376| Best HMM Match : DUF1213 (HMM E-Value=0.18) 27 7.3 SB_13163| Best HMM Match : VWA (HMM E-Value=2.3e-32) 27 7.3 SB_58396| Best HMM Match : Acetyltransf_1 (HMM E-Value=0.0096) 27 7.3 SB_39378| Best HMM Match : VWA (HMM E-Value=0) 27 7.3 SB_8894| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_7134| Best HMM Match : HMG_box (HMM E-Value=2e-16) 27 9.6 SB_49511| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 >SB_55470| Best HMM Match : Nucleoplasmin (HMM E-Value=4.8) Length = 230 Score = 27.1 bits (57), Expect = 7.3 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +2 Query: 17 KLSCFLLRVLACCATEFTWWTIV 85 ++SC L+RV+AC A + W ++ Sbjct: 20 RVSCVLVRVVACLACWYVWTRVL 42 >SB_44915| Best HMM Match : VWA (HMM E-Value=0) Length = 541 Score = 27.1 bits (57), Expect = 7.3 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +1 Query: 118 VIANPDPFFSQP-SNGPSGNYEPISTG 195 VIA PDP S+P +NG G PIS+G Sbjct: 258 VIAEPDPCLSKPCANG--GTCSPISSG 282 >SB_13376| Best HMM Match : DUF1213 (HMM E-Value=0.18) Length = 1022 Score = 27.1 bits (57), Expect = 7.3 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +2 Query: 17 KLSCFLLRVLACCATEFTWWTIV 85 ++SC L+RV+AC A + W ++ Sbjct: 812 RVSCVLVRVVACLACWYVWTRVL 834 >SB_13163| Best HMM Match : VWA (HMM E-Value=2.3e-32) Length = 318 Score = 27.1 bits (57), Expect = 7.3 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +1 Query: 118 VIANPDPFFSQP-SNGPSGNYEPISTG 195 VIA PDP S+P +NG G PIS+G Sbjct: 54 VIAEPDPCLSKPCANG--GTCSPISSG 78 >SB_58396| Best HMM Match : Acetyltransf_1 (HMM E-Value=0.0096) Length = 236 Score = 27.1 bits (57), Expect = 7.3 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 Query: 2 TLFDIKLSCFLLRVLACCATEFTWWTIVVF 91 T FD + FL +L CA WW+ VF Sbjct: 49 TDFDDSMPLFLNSLLFVCAFSLYWWSFWVF 78 >SB_39378| Best HMM Match : VWA (HMM E-Value=0) Length = 2865 Score = 27.1 bits (57), Expect = 7.3 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +1 Query: 118 VIANPDPFFSQP-SNGPSGNYEPISTG 195 VIA PDP S+P +NG G PIS+G Sbjct: 409 VIAEPDPCLSKPCANG--GTCSPISSG 433 >SB_8894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 26.6 bits (56), Expect = 9.6 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 205 VDFNHPNYPPKRYD 246 VD NHPNY P+ Y+ Sbjct: 32 VDLNHPNYLPETYN 45 >SB_7134| Best HMM Match : HMG_box (HMM E-Value=2e-16) Length = 228 Score = 26.6 bits (56), Expect = 9.6 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 73 VDNSGVPSDGHSDHVVIANPDPFFSQ 150 VD+SGV D S +V A +P FSQ Sbjct: 161 VDSSGVAGDQRSSLLVSATLNPLFSQ 186 >SB_49511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 26.6 bits (56), Expect = 9.6 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 73 VDNSGVPSDGHSDHVVIANPDPFFSQ 150 VD+SGV D S +V A +P FSQ Sbjct: 90 VDSSGVAGDQRSSLLVSATLNPLFSQ 115 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,463,481 Number of Sequences: 59808 Number of extensions: 245983 Number of successful extensions: 624 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 622 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 908427626 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -