BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_E16 (621 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A5Z7L5 Cluster: Putative uncharacterized protein; n=1; ... 35 1.8 UniRef50_A7AJ45 Cluster: Putative uncharacterized protein; n=1; ... 33 4.2 UniRef50_Q4U8M2 Cluster: Putative uncharacterized protein; n=1; ... 32 9.6 >UniRef50_A5Z7L5 Cluster: Putative uncharacterized protein; n=1; Eubacterium ventriosum ATCC 27560|Rep: Putative uncharacterized protein - Eubacterium ventriosum ATCC 27560 Length = 196 Score = 34.7 bits (76), Expect = 1.8 Identities = 20/65 (30%), Positives = 31/65 (47%) Frame = -2 Query: 500 MAIAHGTYII*FHTLSILTR**NNYDIINYCRRDSYKLLLSYFIGWLIVFISSFFYKNIL 321 ++ A+ Y+ T TR N++II Y + LL+ FIG ++ F F Y L Sbjct: 107 ISFANFIYLFFTQTEGNQTRCLENFEIIQYTKIKRVALLVILFIGIVLFFTKYFLYSTTL 166 Query: 320 LTILD 306 T +D Sbjct: 167 FTSID 171 >UniRef50_A7AJ45 Cluster: Putative uncharacterized protein; n=1; Parabacteroides merdae ATCC 43184|Rep: Putative uncharacterized protein - Parabacteroides merdae ATCC 43184 Length = 379 Score = 33.5 bits (73), Expect = 4.2 Identities = 14/31 (45%), Positives = 22/31 (70%) Frame = -2 Query: 404 RDSYKLLLSYFIGWLIVFISSFFYKNILLTI 312 R S+ LLS+ G L++F S FF+K++L +I Sbjct: 160 RPSHNRLLSFLFGCLLIFCSFFFHKSMLFSI 190 >UniRef50_Q4U8M2 Cluster: Putative uncharacterized protein; n=1; Theileria annulata|Rep: Putative uncharacterized protein - Theileria annulata Length = 1117 Score = 32.3 bits (70), Expect = 9.6 Identities = 16/40 (40%), Positives = 27/40 (67%), Gaps = 5/40 (12%) Frame = -2 Query: 428 YDIINY--CRRDS---YKLLLSYFIGWLIVFISSFFYKNI 324 Y + NY C ++S YKL+ ++FI +L + ++SFF+K I Sbjct: 115 YKLFNYKLCLQNSLSFYKLIYNFFIYFLKILLNSFFFKKI 154 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 481,804,937 Number of Sequences: 1657284 Number of extensions: 8169594 Number of successful extensions: 18144 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 17368 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18136 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 45221970467 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -