BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_E16 (621 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34158| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 27 9.3 >SB_34158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 506 Score = 28.7 bits (61), Expect = 4.0 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +2 Query: 449 KLIVYGIKLCMCHEQLPFLTYTHE-EREGAYLIIFFLHIMLMFTLIG 586 KL++ G+ L C E LP+L H E + F + + FTL+G Sbjct: 265 KLMILGVWLISCTEPLPYLLSGHRYEYHAGKVFCFQVLEVNFFTLLG 311 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 27.5 bits (58), Expect = 9.3 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 97 VQCIKYNGTVLRMKFKSMYLSKLYIHF*ITY 189 V+ I NGTV+R K + L KL IH + Y Sbjct: 3314 VRGIYKNGTVIRSKLSAKSLKKLPIHIVVYY 3344 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,534,047 Number of Sequences: 59808 Number of extensions: 236245 Number of successful extensions: 399 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 347 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 399 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1536271375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -