BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_E16 (621 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 23 2.4 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 7.3 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 7.3 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 23.0 bits (47), Expect = 2.4 Identities = 13/45 (28%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = -1 Query: 300 LFKQKKNTKEIQLTN*EVK-NIIKSFIFAYLYNTLITYICNLEMY 169 L KQ K +I + + K N++ + ++ YN YI ++E Y Sbjct: 164 LLKQVKIPHDIAINSTTGKRNVVTPIVQSFDYNNTWVYIADVEGY 208 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 231 SFIFAYLYNTLITYI 187 SF+F+ LYN L+ I Sbjct: 673 SFLFSQLYNALLILI 687 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 231 SFIFAYLYNTLITYI 187 SF+F+ LYN L+ I Sbjct: 763 SFLFSQLYNALLILI 777 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,329 Number of Sequences: 438 Number of extensions: 2878 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18460203 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -