BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_E16 (621 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g24230.1 68415.m02894 leucine-rich repeat transmembrane prote... 28 5.7 >At2g24230.1 68415.m02894 leucine-rich repeat transmembrane protein kinase, putative Length = 853 Score = 27.9 bits (59), Expect = 5.7 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = -1 Query: 111 FYALNNL-NTNVGL-QISNSFSKSIEYFYLRKILSIDYN 1 F++LN L N N+ +IS SFS ++ F ++L I YN Sbjct: 111 FWSLNTLKNLNLSFNKISGSFSSNVGNFGQLELLDISYN 149 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,280,358 Number of Sequences: 28952 Number of extensions: 169478 Number of successful extensions: 293 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 293 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1255974912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -