BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_E13 (420 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g17970.1 68417.m02675 expressed protein contains Pfam profile... 33 0.078 At3g18810.1 68416.m02389 protein kinase family protein contains ... 31 0.32 At2g02450.2 68415.m00185 no apical meristem (NAM) family protein... 31 0.32 At2g02450.1 68415.m00184 no apical meristem (NAM) family protein... 31 0.32 At5g10510.1 68418.m01217 ovule development protein, putative sim... 30 0.55 At4g20190.1 68417.m02952 hypothetical protein 30 0.55 At3g22380.1 68416.m02825 expressed protein 30 0.55 At1g18265.1 68414.m02278 expressed protein 30 0.55 At2g32730.1 68415.m04005 26S proteasome regulatory subunit, puta... 29 0.97 At5g24710.1 68418.m02919 WD-40 repeat family protein contains 3 ... 28 2.2 At2g44340.1 68415.m05515 VQ motif-containing protein contains PF... 28 2.2 At2g35940.2 68415.m04412 homeodomain-containing protein contains... 28 2.2 At2g35940.1 68415.m04411 homeodomain-containing protein contains... 28 2.2 At4g29230.1 68417.m04181 no apical meristem (NAM) family protein... 27 3.9 At5g03415.1 68418.m00294 DPB-1 transcription factor, putative (D... 27 5.2 At4g17750.1 68417.m02650 heat shock factor protein 1 (HSF1) / he... 27 5.2 At3g54930.1 68416.m06087 serine/threonine protein phosphatase 2A... 27 5.2 At1g79250.1 68414.m09239 protein kinase, putative similar to vir... 27 5.2 At1g21610.2 68414.m02703 wound-responsive family protein similar... 27 5.2 At1g21610.1 68414.m02702 wound-responsive family protein similar... 27 5.2 At5g39990.1 68418.m04849 glycosyltransferase family 14 protein /... 27 6.8 At5g02460.1 68418.m00173 Dof-type zinc finger domain-containing ... 27 6.8 At3g14180.1 68416.m01792 expressed protein similar to 6b-interac... 27 6.8 At2g43970.2 68415.m05468 La domain-containing protein contains P... 27 6.8 At2g43970.1 68415.m05467 La domain-containing protein contains P... 27 6.8 At5g42050.1 68418.m05119 expressed protein similar to gda-1 [Pis... 26 9.0 At2g15860.1 68415.m01818 expressed protein and genefinder 26 9.0 >At4g17970.1 68417.m02675 expressed protein contains Pfam profile PF01027: Uncharacterized protein family UPF0005 Length = 560 Score = 33.1 bits (72), Expect = 0.078 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +2 Query: 74 NNRHHKAN-SNNRHHKANSNNSLHKANSNNSL 166 NN+H + SNN+HH+ NS+NS N + SL Sbjct: 390 NNKHQNGSISNNKHHQRNSSNSGKDLNGDVSL 421 Score = 27.5 bits (58), Expect = 3.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 71 SNNRHHKANSNNRHHKANSNNSLHKANS 154 SNN+HH+ NS+N N + SL + Sbjct: 399 SNNKHHQRNSSNSGKDLNGDVSLQNTET 426 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 31.1 bits (67), Expect = 0.32 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +2 Query: 68 NSNNRHHKANSNNRHHKANSNNSLHKANSNN 160 N NN + N+NN ++ ++NN +K N+NN Sbjct: 77 NGNNNNDNNNNNNGNNNNDNNNGNNKDNNNN 107 Score = 30.3 bits (65), Expect = 0.55 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = +2 Query: 68 NSNNRHHKANSNNRHHKANSNNSLHKANSNN 160 N NN ++ N+NN ++ N+ ++ + N+NN Sbjct: 82 NDNNNNNNGNNNNDNNNGNNKDNNNNGNNNN 112 Score = 29.5 bits (63), Expect = 0.97 Identities = 11/32 (34%), Positives = 22/32 (68%) Frame = +2 Query: 68 NSNNRHHKANSNNRHHKANSNNSLHKANSNNS 163 N+NN ++ ++NN ++K N+NN + +NN+ Sbjct: 86 NNNNGNNNNDNNNGNNKDNNNNGNNNNGNNNN 117 Score = 29.1 bits (62), Expect = 1.3 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 68 NSNNRHHKANSNNRHHKANSNNSLHKANSNNS 163 N+N+ ++ N NN + N NN + N NN+ Sbjct: 80 NNNDNNNNNNGNNNNDNNNGNNKDNNNNGNNN 111 Score = 28.7 bits (61), Expect = 1.7 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 68 NSNNRHHKANSNNRHHKANSNNSLHKANSNNS 163 N+NN + N NN + ++NN+ + N NN+ Sbjct: 85 NNNNNGNNNNDNNNGNNKDNNNNGNNNNGNNN 116 Score = 28.7 bits (61), Expect = 1.7 Identities = 11/32 (34%), Positives = 22/32 (68%) Frame = +2 Query: 68 NSNNRHHKANSNNRHHKANSNNSLHKANSNNS 163 ++NN ++K N+NN ++ +NN+ + N NN+ Sbjct: 95 DNNNGNNKDNNNNGNNNNGNNNNGNDNNGNNN 126 Score = 28.3 bits (60), Expect = 2.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 59 HKFNSNNRHHKANSNNRHHKANSNNSLHKANSNNS 163 +K N+NN ++ +NN + N NN+ N NN+ Sbjct: 101 NKDNNNNGNNNNGNNNNGNDNNGNNNNGNNNDNNN 135 Score = 27.5 bits (58), Expect = 3.9 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +2 Query: 68 NSNNRHHKANSNNRHHKANSNNSLHKANSNNS 163 N+ N ++ N+NN + N NN+ + ++NN+ Sbjct: 76 NNGNNNNDNNNNNNGNNNNDNNNGNNKDNNNN 107 Score = 27.1 bits (57), Expect = 5.2 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 56 PHKFNSNNRHHKANSNNRHHKANSNNSLHKANSNNSLHK 172 P NN + N NN + N+NN + ++NN +K Sbjct: 64 PPSPQGNNNNDGNNGNNNNDNNNNNNGNNNNDNNNGNNK 102 Score = 26.2 bits (55), Expect = 9.0 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +2 Query: 68 NSNNRHHKANSNNRHHKANSNNSLHKANSNNS 163 N N + N NN ++ N+NN + N+ ++ Sbjct: 73 NDGNNGNNNNDNNNNNNGNNNNDNNNGNNKDN 104 Score = 26.2 bits (55), Expect = 9.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 68 NSNNRHHKANSNNRHHKANSNNSLHKANSNN 160 N NN+ + N NN + N+ N + N+NN Sbjct: 98 NGNNKDNNNNGNNNNGNNNNGND-NNGNNNN 127 >At2g02450.2 68415.m00185 no apical meristem (NAM) family protein contains Pfam PF02365: No apical meristem (NAM) domain Length = 414 Score = 31.1 bits (67), Expect = 0.32 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +2 Query: 59 HKFNSNNRHHKANSNNRHHKANSNNSLHKANSNNSLH 169 H NS+ A +HH ++SN+S + N+NN+++ Sbjct: 216 HNHNSSTSSRLALRQQQHHSSSSNHSDNNLNNNNNIN 252 >At2g02450.1 68415.m00184 no apical meristem (NAM) family protein contains Pfam PF02365: No apical meristem (NAM) domain Length = 379 Score = 31.1 bits (67), Expect = 0.32 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +2 Query: 59 HKFNSNNRHHKANSNNRHHKANSNNSLHKANSNNSLH 169 H NS+ A +HH ++SN+S + N+NN+++ Sbjct: 216 HNHNSSTSSRLALRQQQHHSSSSNHSDNNLNNNNNIN 252 >At5g10510.1 68418.m01217 ovule development protein, putative similar to ovule development protein aintegumenta (GI:1209099) [Arabidopsis thaliana] Length = 566 Score = 30.3 bits (65), Expect = 0.55 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +2 Query: 68 NSNNRHHKANSNNRHHKANSNNSLHKANSNNSLHK 172 N NN + N N+ H++ N+N N+NN K Sbjct: 187 NVNNNTNHRNDNDNHYRGNNNGERINNNNNNDNEK 221 Score = 27.9 bits (59), Expect = 3.0 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +2 Query: 68 NSNNRHHKANSNNRHHKANSNNSLHKANS 154 N N+ H++ N+N N+NN K +S Sbjct: 196 NDNDNHYRGNNNGERINNNNNNDNEKTDS 224 >At4g20190.1 68417.m02952 hypothetical protein Length = 389 Score = 30.3 bits (65), Expect = 0.55 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 71 SNNRHHKANSNNRHHKANSNNSLHKANSNNS 163 S N HH N + +NS + HK++ NNS Sbjct: 150 SRNAHHNQNHHRGFSSSNSKSLSHKSSGNNS 180 Score = 27.5 bits (58), Expect = 3.9 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +2 Query: 68 NSNNRHHKANSNNRHHKANSNNSLHKANSNNSLHK 172 NS + HK++ NN +N +++NSN + K Sbjct: 167 NSKSLSHKSSGNNSFFSKTESNKSNRSNSNTANSK 201 Score = 26.6 bits (56), Expect = 6.8 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 5/42 (11%) Frame = +2 Query: 53 KPHKFNSNNRHHK----ANSNNRHHKANSNNS-LHKANSNNS 163 K + N HH+ +NS + HK++ NNS K SN S Sbjct: 149 KSRNAHHNQNHHRGFSSSNSKSLSHKSSGNNSFFSKTESNKS 190 >At3g22380.1 68416.m02825 expressed protein Length = 1550 Score = 30.3 bits (65), Expect = 0.55 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 68 NSNNRHHKANSNNRHHKANSNNSLHKANSN 157 +S + HH S N HH +S+N+ H+ +N Sbjct: 144 SSLSNHHNGGSGNLHHHHHSHNNNHQRKNN 173 >At1g18265.1 68414.m02278 expressed protein Length = 280 Score = 30.3 bits (65), Expect = 0.55 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 65 FNSNNRHHKANSNNRHHKANSNNSLHKANSNNSL 166 FNS NR HK +NN ++ N+N + K++ + L Sbjct: 78 FNSFNREHKDCNNNNNNNNNNNGFISKSHLADGL 111 >At2g32730.1 68415.m04005 26S proteasome regulatory subunit, putative contains similarity to 26S proteasome regulatory subunit S1 SP:O88761, GI:3288594 from [Rattus norvegicus] Length = 1004 Score = 29.5 bits (63), Expect = 0.97 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +3 Query: 252 ARSKPNTITTGSSKSIPTATTSMAIPTTVTSNSIPGTA 365 + +KP+ ++PTA T++ +PT V S S+ A Sbjct: 814 SHAKPSLFEYPKPTTVPTANTAVKLPTAVLSTSVKAKA 851 >At5g24710.1 68418.m02919 WD-40 repeat family protein contains 3 Pfam PF00400: WD domain, G-beta repeats; Length = 1327 Score = 28.3 bits (60), Expect = 2.2 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = +3 Query: 270 TITTGSSKSIPTATTSMAIPTTVTSNSIPGTAACSTTIAKARYPPIVS 413 T T S + P + A P TVT+ ++ T +T YPPI S Sbjct: 1270 TTTPESVTTAPPEPITTAPPETVTTTAVKPTENAATERRVTNYPPIRS 1317 >At2g44340.1 68415.m05515 VQ motif-containing protein contains PF05678: VQ motif Length = 188 Score = 28.3 bits (60), Expect = 2.2 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +2 Query: 65 FNSNNRHHKANSNNRHHKANSNNSLHKAN 151 FN+NN ++ N+NN ++ N + H ++ Sbjct: 160 FNNNNNNNNNNNNNNNNNTNFDTKAHNSS 188 >At2g35940.2 68415.m04412 homeodomain-containing protein contains 'Homeobox' domain signature, Prosite:PS00027 Length = 680 Score = 28.3 bits (60), Expect = 2.2 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 68 NSNNRHHKANSNNRHHKANSNNS 136 N+NN + +N+NN + N+NNS Sbjct: 42 NNNNNSNNSNNNNTNTNTNNNNS 64 Score = 27.9 bits (59), Expect = 3.0 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +2 Query: 92 ANSNNRHHKANSNNSLHKANSNNS 163 +N+NN + +N+NN+ N+NNS Sbjct: 41 SNNNNNSNNSNNNNTNTNTNNNNS 64 Score = 27.5 bits (58), Expect = 3.9 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 68 NSNNRHHKANSNNRHHKANSNNS 136 +SNN ++ NSNN + N+NN+ Sbjct: 40 DSNNNNNSNNSNNNNTNTNTNNN 62 Score = 26.2 bits (55), Expect = 9.0 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 95 NSNNRHHKANSNNSLHKANSNNS 163 +SNN ++ NSNN+ N+NN+ Sbjct: 40 DSNNNNNSNNSNNNNTNTNTNNN 62 >At2g35940.1 68415.m04411 homeodomain-containing protein contains 'Homeobox' domain signature, Prosite:PS00027 Length = 680 Score = 28.3 bits (60), Expect = 2.2 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 68 NSNNRHHKANSNNRHHKANSNNS 136 N+NN + +N+NN + N+NNS Sbjct: 42 NNNNNSNNSNNNNTNTNTNNNNS 64 Score = 27.9 bits (59), Expect = 3.0 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +2 Query: 92 ANSNNRHHKANSNNSLHKANSNNS 163 +N+NN + +N+NN+ N+NNS Sbjct: 41 SNNNNNSNNSNNNNTNTNTNNNNS 64 Score = 27.5 bits (58), Expect = 3.9 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 68 NSNNRHHKANSNNRHHKANSNNS 136 +SNN ++ NSNN + N+NN+ Sbjct: 40 DSNNNNNSNNSNNNNTNTNTNNN 62 Score = 26.2 bits (55), Expect = 9.0 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 95 NSNNRHHKANSNNSLHKANSNNS 163 +SNN ++ NSNN+ N+NN+ Sbjct: 40 DSNNNNNSNNSNNNNTNTNTNNN 62 >At4g29230.1 68417.m04181 no apical meristem (NAM) family protein similar to NAM family proteins GP|12751304|, GP|6223650|, GP|9758909 - Arabidopsis thaliana,PIR2:T04621 Length = 498 Score = 27.5 bits (58), Expect = 3.9 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +2 Query: 59 HKFNSNNRHHKANSNNRHHKANSNNSLHKANSNNSLH 169 H+ +S+ HH A+ ++ HH H N + H Sbjct: 347 HQPSSSTSHHMAHDHHHHHHQQQQQRHHAFNISQPTH 383 >At5g03415.1 68418.m00294 DPB-1 transcription factor, putative (DPB) similar to Swiss-Prot:Q14186 transcription factor DP-1 [Homo sapiens]; contains Pfam profile PF02319: Transcription factor E2F/dimerisation partner (TDP) Length = 385 Score = 27.1 bits (57), Expect = 5.2 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 68 NSNNRHHKANSNNRHHKANS 127 NSN+ HH++N+NN + S Sbjct: 7 NSNHNHHESNNNNNNPSTRS 26 Score = 26.6 bits (56), Expect = 6.8 Identities = 8/15 (53%), Positives = 14/15 (93%) Frame = +2 Query: 92 ANSNNRHHKANSNNS 136 +NSN+ HH++N+NN+ Sbjct: 6 SNSNHNHHESNNNNN 20 >At4g17750.1 68417.m02650 heat shock factor protein 1 (HSF1) / heat shock transcription factor 1 (HSTF1) identical to heat shock transcription factor 1 (HSF1) SP:P41151 from [Arabidopsis thaliana] ;contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 495 Score = 27.1 bits (57), Expect = 5.2 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 68 NSNNRHHKANSNNRHHKANSNNSLH 142 N+NN ++ N+NN ++ N+ N H Sbjct: 454 NNNNNNNNNNNNNNNNNNNNTNGRH 478 >At3g54930.1 68416.m06087 serine/threonine protein phosphatase 2A (PP2A) regulatory subunit B', putative similar to SWISS-PROT:Q28653 serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, delta isoform (PP2A, B subunit, B' delta isoform, PP2A, B subunit, B56 delta isoform, PP2A, B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta isoform, PP2A, B subunit, B'-gamma) [Oryctolagus cuniculus]; contains Pfam domain, PF01603: Protein phosphatase 2A regulatory B subunit (B56 family) Length = 497 Score = 27.1 bits (57), Expect = 5.2 Identities = 8/22 (36%), Positives = 17/22 (77%) Frame = +2 Query: 62 KFNSNNRHHKANSNNRHHKANS 127 KFN +++HH+ N+NN ++ + + Sbjct: 12 KFNKSDQHHQDNNNNNNNTSTN 33 >At1g79250.1 68414.m09239 protein kinase, putative similar to viroid symptom modulation protein/dual-specificity protein kinase [Lycopersicon esculentum] gi|7672777|gb|AAF66637 Length = 555 Score = 27.1 bits (57), Expect = 5.2 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 68 NSNNRHHKANSNNRHHKANSNNSLHKANSNNS 163 N N + + NSNN + ++ +NS+ +SN S Sbjct: 87 NLNTKPNNNNSNNNSNMSSRSNSIESTSSNPS 118 >At1g21610.2 68414.m02703 wound-responsive family protein similar to wound-responsive protein 14.05 (GI:16506638) [Castanea sativa]; ESTs gb T42839 and gb|AA395192 come from this gene Length = 683 Score = 27.1 bits (57), Expect = 5.2 Identities = 11/37 (29%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = +2 Query: 68 NSNNRHHKANSNNRH--HKANSNNSLHKANSNNSLHK 172 +S+ +H++ ++ H + S+++LH+ SN SLH+ Sbjct: 242 HSDRANHQSRNDTSHKSRETGSSSALHQKYSNKSLHQ 278 >At1g21610.1 68414.m02702 wound-responsive family protein similar to wound-responsive protein 14.05 (GI:16506638) [Castanea sativa]; ESTs gb T42839 and gb|AA395192 come from this gene Length = 684 Score = 27.1 bits (57), Expect = 5.2 Identities = 11/37 (29%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = +2 Query: 68 NSNNRHHKANSNNRH--HKANSNNSLHKANSNNSLHK 172 +S+ +H++ ++ H + S+++LH+ SN SLH+ Sbjct: 242 HSDRANHQSRNDTSHKSRETGSSSALHQKYSNKSLHQ 278 >At5g39990.1 68418.m04849 glycosyltransferase family 14 protein / core-2/I-branching enzyme family protein contains Pfam profile: PF02485 Core-2/I-Branching enzyme Length = 447 Score = 26.6 bits (56), Expect = 6.8 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +2 Query: 53 KPHKFNSNNRHHKANSNNRHHKANSNNSLHK 145 K + SN RHH+ + ++ HH +N +S K Sbjct: 3 KLRSYYSNVRHHQNHHHHHHHHSNIVSSERK 33 >At5g02460.1 68418.m00173 Dof-type zinc finger domain-containing protein zinc finger protein OBP3, Arabidopsis thaliana, EMBL:AF155818 Length = 399 Score = 26.6 bits (56), Expect = 6.8 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = +2 Query: 68 NSNNRHHKANSNNRHHKANSNNSLHKANSNNSL 166 NS ++ +++ HH+A +NN + +S++SL Sbjct: 165 NSKSQDSATSNDQYHHRAMANNQMGPPSSSSSL 197 >At3g14180.1 68416.m01792 expressed protein similar to 6b-interacting protein 1 (NtSIP1) [Nicotiana tabacum] GI:18149189 Length = 443 Score = 26.6 bits (56), Expect = 6.8 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 68 NSNNRHHKANSNNRHHKANSNNSL 139 N++N HH + NN + N+NN L Sbjct: 417 NTSNDHHHSRKNNINAIVNNNNDL 440 >At2g43970.2 68415.m05468 La domain-containing protein contains Pfam profile PF05383: La domain Length = 529 Score = 26.6 bits (56), Expect = 6.8 Identities = 8/32 (25%), Positives = 18/32 (56%) Frame = +2 Query: 47 KAKPHKFNSNNRHHKANSNNRHHKANSNNSLH 142 + +PH+ + N +H N N+ H+ +++ H Sbjct: 447 RGQPHQNQNQNNNHSHNQNHNHNGRGNHHHHH 478 >At2g43970.1 68415.m05467 La domain-containing protein contains Pfam profile PF05383: La domain Length = 545 Score = 26.6 bits (56), Expect = 6.8 Identities = 8/32 (25%), Positives = 18/32 (56%) Frame = +2 Query: 47 KAKPHKFNSNNRHHKANSNNRHHKANSNNSLH 142 + +PH+ + N +H N N+ H+ +++ H Sbjct: 463 RGQPHQNQNQNNNHSHNQNHNHNGRGNHHHHH 494 >At5g42050.1 68418.m05119 expressed protein similar to gda-1 [Pisum sativum] GI:2765418 Length = 349 Score = 26.2 bits (55), Expect = 9.0 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +2 Query: 68 NSNNRHHKANSNNRHHKANSNNSLHKANSNNSLHK 172 + +++ K NR ++ N+NN ++ + NN L K Sbjct: 165 DEDHQIQKGGKKNRKNQQNNNNQRNEDDKNNGLDK 199 >At2g15860.1 68415.m01818 expressed protein and genefinder Length = 512 Score = 26.2 bits (55), Expect = 9.0 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 359 HRSLFNNNRKGKVSPNRLSL 418 H +L N RKGK+SP++ SL Sbjct: 262 HYTLLFNRRKGKLSPDQKSL 281 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.275 0.102 0.280 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,053,564 Number of Sequences: 28952 Number of extensions: 34667 Number of successful extensions: 186 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 166 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 645327280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 18 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 47 (21.9 bits)
- SilkBase 1999-2023 -