BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_E12 (276 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 23 2.1 U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase... 22 3.7 U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase... 22 3.7 Z69981-1|CAA93821.1| 327|Anopheles gambiae maltase precursor pr... 22 4.9 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 22 4.9 DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 21 6.4 AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 21 6.4 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 21 6.4 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 23.0 bits (47), Expect = 2.1 Identities = 8/37 (21%), Positives = 17/37 (45%) Frame = +2 Query: 26 TNNHLGSEQLWWSSV*TDVWQCCRIMLGRSSTSLEQE 136 + H G WW+ + + CR+ R ++++E Sbjct: 283 SQGHSGRPAYWWTPAIEVLCENCRLAKERLEAAIDEE 319 >U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase protein. Length = 260 Score = 22.2 bits (45), Expect = 3.7 Identities = 6/16 (37%), Positives = 8/16 (50%) Frame = +2 Query: 23 FTNNHLGSEQLWWSSV 70 F HL + WWS + Sbjct: 53 FAEEHLAASIFWWSKI 68 >U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase protein. Length = 332 Score = 22.2 bits (45), Expect = 3.7 Identities = 6/16 (37%), Positives = 8/16 (50%) Frame = +2 Query: 23 FTNNHLGSEQLWWSSV 70 F HL + WWS + Sbjct: 125 FAEEHLAASIFWWSKI 140 >Z69981-1|CAA93821.1| 327|Anopheles gambiae maltase precursor protein. Length = 327 Score = 21.8 bits (44), Expect = 4.9 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 15 GMSLQITISEVNNFGGHQFKRMFGNVVELCS 107 G S+ + E+ NFG + FG+ +E+ S Sbjct: 227 GDSVLAVVRELTNFGTYITLANFGSQIEVIS 257 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 21.8 bits (44), Expect = 4.9 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +3 Query: 81 FGNVVELCSDAAVQVW 128 FGN +CS +++ VW Sbjct: 843 FGNGFLMCSASSIDVW 858 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 21.4 bits (43), Expect = 6.4 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -3 Query: 58 PKLFTSEMVICKDMP 14 P L SE+ +C+ MP Sbjct: 189 PALLASELKLCQQMP 203 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 21.4 bits (43), Expect = 6.4 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = -1 Query: 228 VTSIRLIFLQN*GPLNIYEMLHTDQTHLKKASCSKLVLLRP 106 +TS+ LQ P ++ H + A +LVLL P Sbjct: 541 ITSLTYANLQFLAPAITVDLRHNSIFEIDLADMERLVLLEP 581 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 21.4 bits (43), Expect = 6.4 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -3 Query: 223 FNTTNFSSKLRSIKYL*NASHRSDAFE 143 F+ T F S LRS ++ A+H E Sbjct: 244 FDPTLFESALRSTRFEDRATHAKSRIE 270 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 296,109 Number of Sequences: 2352 Number of extensions: 5290 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 54 effective length of database: 436,971 effective search space used: 16167927 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -