BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_E09 (557 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17C9.03 |tif471||translation initiation factor eIF4G |Schizo... 31 0.11 SPAC26A3.09c |rga2||GTPase activating protein Rga2|Schizosacchar... 28 1.1 SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|c... 26 3.3 SPCC1183.08c |rpl101|rpl1-1, rpl10a-1|60S ribosomal protein L10a... 26 4.3 SPAC29B12.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 26 4.3 SPAC589.06c |||pho88 family protein|Schizosaccharomyces pombe|ch... 26 4.3 SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr ... 25 5.7 SPAC4A8.13c |pts1||20S proteasome component beta 5|Schizosacchar... 25 5.7 SPAC30D11.06c |||DUF300 family protein|Schizosaccharomyces pombe... 25 5.7 SPBC31F10.11c |cwf4|syf3|complexed with Cdc5 protein Cwf4 |Schiz... 25 5.7 SPAC167.01 |ppk4||serine/threonine protein kinase Ppk4 |Schizosa... 25 7.5 SPAC23D3.14c |aah2||alpha-amylase homolog Aah2|Schizosaccharomyc... 25 10.0 SPBC30D10.18c |rpl102|rpl1-2, rpl10a-2|60S ribosomal protein L10... 25 10.0 >SPAC17C9.03 |tif471||translation initiation factor eIF4G |Schizosaccharomyces pombe|chr 1|||Manual Length = 1403 Score = 31.1 bits (67), Expect = 0.11 Identities = 23/89 (25%), Positives = 39/89 (43%) Frame = -1 Query: 323 RSQEDLDNGISGNIGLNVDGNTERLVVESWLTNLEVVWVTSLNLFFGQEYTVSGIKLAIV 144 R QED + G N+ G E + E ++ L F G+ + +S + I+ Sbjct: 1109 RCQEDFERGWKANLPSGKAGEAEIMSDEYYVAAAIKRRGLGLVRFIGELFKLSMLSEKIM 1168 Query: 143 KECD*FLNDNIIDFNADEMKFLLRIRLQV 57 EC L N+ D +E++ L R+ + V Sbjct: 1169 HECIKRLLGNVTDPEEEEIESLCRLLMTV 1197 >SPAC26A3.09c |rga2||GTPase activating protein Rga2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1275 Score = 27.9 bits (59), Expect = 1.1 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +3 Query: 375 FYELDWFTHKITPGQNKIVRNSNE--FSLFKEDSLPLTDLMKLLD 503 F LDWFT+ + QN+++R S + F + L L +KLL+ Sbjct: 654 FPTLDWFTNDSSVIQNELLRRSVDTYFRYIFQTDLKLEQRIKLLE 698 >SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 796 Score = 26.2 bits (55), Expect = 3.3 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +3 Query: 303 IKIFLGPKYNDDGFPITLEENWHKFYELDWFTHKIT 410 + I L P ND + T WHKF++ WF +T Sbjct: 416 LHIELAPAANDIQWHNTYIGRWHKFFQ-GWFITLVT 450 >SPCC1183.08c |rpl101|rpl1-1, rpl10a-1|60S ribosomal protein L10a|Schizosaccharomyces pombe|chr 3|||Manual Length = 216 Score = 25.8 bits (54), Expect = 4.3 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -2 Query: 517 GTFPSSNNFMRSVNGKESSLKSENSFELRTILFCPGV 407 G FPS + + GK + +KS F+L+ +L C GV Sbjct: 131 GKFPSPVSHADDLYGKITEVKSTIKFQLKKVL-CLGV 166 >SPAC29B12.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 682 Score = 25.8 bits (54), Expect = 4.3 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = +3 Query: 189 KEIKTSYPHNFKVRQPRLNHKPFSVTIDVKSDIATDAVIKIFLGPKYNDDGFPI 350 + I+ SYP+ F R P+ H P + +D + A + V L P+ N + P+ Sbjct: 606 QHIQYSYPNTFVNRFPQNIHHPSANLLDASA--ALNPVQNPLLMPQQNHEHSPL 657 >SPAC589.06c |||pho88 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 202 Score = 25.8 bits (54), Expect = 4.3 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -2 Query: 556 LFGMHSKPSDIYNGTFPSSNNFMRSVNGKESSLKSENSFE 437 LFG +KP+ GT +SNN +G + +EN E Sbjct: 160 LFGGGNKPAAAVTGTSSNSNNASAKSDGPTITELNENETE 199 >SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr 1|||Manual Length = 1854 Score = 25.4 bits (53), Expect = 5.7 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = -1 Query: 278 LNVDGNTERLVVESWLTNLEVVWVTSLNLFFGQEYTVSGI---KLAIVKEC 135 LN+ TE ++ ++ +V V S N FFG + G+ K ++ ++C Sbjct: 309 LNITRKTETILKSLKESSTPLVQVVSFNAFFGVMIAILGVQFFKASLNRQC 359 >SPAC4A8.13c |pts1||20S proteasome component beta 5|Schizosaccharomyces pombe|chr 1|||Manual Length = 272 Score = 25.4 bits (53), Expect = 5.7 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = -2 Query: 370 CQFSSNVMGNPSSLYLGPKKILITASVAISDLTSMV-TLKGLWLSRG 233 CQF V+G L+ K LI+ S A L+++ + KG LS G Sbjct: 113 CQFWETVLGMECRLHQLRNKELISVSAASKILSNITYSYKGYGLSMG 159 >SPAC30D11.06c |||DUF300 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 426 Score = 25.4 bits (53), Expect = 5.7 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +1 Query: 322 LSTTMMDSPSHWKKTGINSTNWIG 393 LS + S+W++T ++ TNW+G Sbjct: 208 LSVKAIIFASYWQQTVLSITNWLG 231 >SPBC31F10.11c |cwf4|syf3|complexed with Cdc5 protein Cwf4 |Schizosaccharomyces pombe|chr 2|||Manual Length = 674 Score = 25.4 bits (53), Expect = 5.7 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Frame = +3 Query: 123 EKLVTFFDYSQFDATNSVFLTKKEIKTSYPHNFKVRQPRLNHKPFSVTID-VKSDIATD 296 E++V + QF+A + T+K + + P K R+ RL F +D + D ATD Sbjct: 591 ERVVLLEAWKQFEAMHGTEDTRKHVSSLMPQVVKKRR-RLEDGSFEEYLDYLFPDTATD 648 >SPAC167.01 |ppk4||serine/threonine protein kinase Ppk4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1072 Score = 25.0 bits (52), Expect = 7.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 4 HSISYITGLWVTLTHSSIT*SLILKRNFISSALKSMMLSLRN*SH 138 +S S I W T HSS+ +L R + S + ++ LRN H Sbjct: 973 NSKSVIGENWTTCLHSSLVDNLGKYRKYDGSKILDILRVLRNKRH 1017 >SPAC23D3.14c |aah2||alpha-amylase homolog Aah2|Schizosaccharomyces pombe|chr 1|||Manual Length = 581 Score = 24.6 bits (51), Expect = 10.0 Identities = 12/43 (27%), Positives = 25/43 (58%), Gaps = 4/43 (9%) Frame = +3 Query: 15 LYNRIVGYINAFKHYLKP----YPQEKLHFVGVKINDVVVEKL 131 +Y +++G +N F+ ++ Y + + VKI+ +VV+KL Sbjct: 385 VYYKLIGILNRFRKSVQRQEENYVNTRSTILSVKIHHIVVQKL 427 >SPBC30D10.18c |rpl102|rpl1-2, rpl10a-2|60S ribosomal protein L10a|Schizosaccharomyces pombe|chr 2|||Manual Length = 216 Score = 24.6 bits (51), Expect = 10.0 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -2 Query: 517 GTFPSSNNFMRSVNGKESSLKSENSFELRTILFCPGV 407 G FPS + + GK +KS F+L+ +L C GV Sbjct: 131 GKFPSPVSHSDDLYGKIIEVKSTIKFQLKKVL-CLGV 166 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,255,047 Number of Sequences: 5004 Number of extensions: 45946 Number of successful extensions: 147 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 147 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 233995432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -