BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_E09 (557 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49488| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.64 SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) 29 2.6 SB_8348| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_7722| Best HMM Match : TFR_dimer (HMM E-Value=2.6e-10) 29 3.4 SB_36304| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_54290| Best HMM Match : Pkinase (HMM E-Value=1.3e-26) 28 5.9 SB_7240| Best HMM Match : OMPdecase (HMM E-Value=0) 28 5.9 SB_23914| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 >SB_49488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1228 Score = 31.1 bits (67), Expect = 0.64 Identities = 18/99 (18%), Positives = 45/99 (45%), Gaps = 1/99 (1%) Frame = +3 Query: 153 QFDATNSVFLTKKEIKTSYPHNFKVRQPRLNHKPFSVTIDVKSDIATDAVIKIFLGPKYN 332 + D +SV + + + S + +++ ++ + + I V + + + I Y Sbjct: 273 ELDTGSSVSIIPRNVYESTCKHLELKPAKVKLRTYGSEIIVPMGVVSARTLVITTNAMYV 332 Query: 333 DDGFPITL-EENWHKFYELDWFTHKITPGQNKIVRNSNE 446 DG + L +W + ++L+W + K+ G+N + + E Sbjct: 333 VDGPRVALFGRSWLRLFKLEWPSIKLVQGKNTALSDLTE 371 Score = 31.1 bits (67), Expect = 0.64 Identities = 18/99 (18%), Positives = 45/99 (45%), Gaps = 1/99 (1%) Frame = +3 Query: 153 QFDATNSVFLTKKEIKTSYPHNFKVRQPRLNHKPFSVTIDVKSDIATDAVIKIFLGPKYN 332 + D +SV + + + S + +++ ++ + + I V + + + I Y Sbjct: 756 ELDTGSSVSIIPRNVYESTCKHLELKPAKVKLRTYGSEIIVPMGVVSARTLVITTNAMYV 815 Query: 333 DDGFPITL-EENWHKFYELDWFTHKITPGQNKIVRNSNE 446 DG + L +W + ++L+W + K+ G+N + + E Sbjct: 816 VDGPRVALFGRSWLRLFKLEWPSIKLVQGKNTALSDLTE 854 >SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) Length = 129 Score = 29.1 bits (62), Expect = 2.6 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +1 Query: 7 SISYITGLWVTLTHSSIT*SLILKRNFISSALKSMMLSLRN*SHS-LTIANLMPLTV 174 ++++ T + +TLTHS++T + N S L L+ N +HS LT + L LT+ Sbjct: 1 TLTHPTLIHLTLTHSNLTHLTLTHSNLTHSTLTHSNLTHLNLTHSTLTYSTLTHLTL 57 >SB_8348| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 455 Score = 29.1 bits (62), Expect = 2.6 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +3 Query: 321 PKYNDDGFPITLEENWHKFYELDWFTHKITPGQNKIVR-NSNEFSLFKEDSLPLTDLMKL 497 PK P + E+ KFYE + + +I PG+ + V N N + ++ L L +L +L Sbjct: 160 PKKGGRALPSDVLEHIVKFYESEEYP-RICPGKKEFVSVNENNVKVHRQKQLLLVNLHEL 218 Query: 498 LDEGK 512 E K Sbjct: 219 YVEYK 223 >SB_7722| Best HMM Match : TFR_dimer (HMM E-Value=2.6e-10) Length = 688 Score = 28.7 bits (61), Expect = 3.4 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -1 Query: 311 DLDNGISGNIGLNVDGN 261 ++D G+SGN LNVDG+ Sbjct: 397 NIDTGVSGNFSLNVDGS 413 >SB_36304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 28.3 bits (60), Expect = 4.5 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 360 ENWHKFYELDWFTHKITPGQNKIVRN 437 + WHK YELD F K + N I+RN Sbjct: 66 KEWHK-YELDKFMEKTSSYHNTILRN 90 >SB_54290| Best HMM Match : Pkinase (HMM E-Value=1.3e-26) Length = 239 Score = 27.9 bits (59), Expect = 5.9 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = +3 Query: 366 WHKFYELDWFTHKITPGQNKIVRNSNEFSLFKEDSLPLTDLMKLLD 503 W L F H I P + R EF+ ED+L L D M LD Sbjct: 167 WPSIINLPHF-HSIKPKRQYRRRIREEFNFLPEDALDLFDAMLTLD 211 >SB_7240| Best HMM Match : OMPdecase (HMM E-Value=0) Length = 474 Score = 27.9 bits (59), Expect = 5.9 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +3 Query: 84 LHFVGVKINDVVVEKLVTFFDYSQFDATNSV 176 LH G K++D VVE + F + +QF AT+ V Sbjct: 181 LHAQG-KVDDAVVESVREFLEANQFKATSDV 210 >SB_23914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 587 Score = 27.5 bits (58), Expect = 7.9 Identities = 12/27 (44%), Positives = 20/27 (74%), Gaps = 2/27 (7%) Frame = -1 Query: 311 DLDNGISGNIGLNVDGNT--ERLVVES 237 ++D G+ GN LN+DG+ E+L+VE+ Sbjct: 340 NIDVGVGGNFTLNMDGSALIEKLLVET 366 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,122,861 Number of Sequences: 59808 Number of extensions: 318114 Number of successful extensions: 854 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 802 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 850 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1300738331 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -