BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_E09 (557 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X87241-1|CAA60685.1| 4590|Homo sapiens homologue of Drosophila F... 36 0.13 BC059402-1|AAH59402.1| 842|Homo sapiens round spermatid basic p... 29 8.4 >X87241-1|CAA60685.1| 4590|Homo sapiens homologue of Drosophila Fat protein protein. Length = 4590 Score = 35.5 bits (78), Expect = 0.13 Identities = 16/50 (32%), Positives = 31/50 (62%) Frame = -1 Query: 347 GESIIVVLRSQEDLDNGISGNIGLNVDGNTERLVVESWLTNLEVVWVTSL 198 G S ++ +R+ D D+G +G + ++D + V+ES+ N+E W+T+L Sbjct: 2826 GGSRVIQIRAS-DADSGTNGQVMYSLDQSQSVEVIESFAINMETGWITTL 2874 >BC059402-1|AAH59402.1| 842|Homo sapiens round spermatid basic protein 1-like protein. Length = 842 Score = 29.5 bits (63), Expect = 8.4 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 129 LVTFFDYSQFDATNSVFLTKKEIKTSYPHNFKVRQPR 239 L F DY F+ NS L KK+I+T+ NF + R Sbjct: 411 LPDFLDYFSFNFPNSPVLGKKDIETTTMSNFHAQVKR 447 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,713,539 Number of Sequences: 237096 Number of extensions: 1501826 Number of successful extensions: 13920 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13864 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13920 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5590411794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -