BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_E08 (490 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_385| Best HMM Match : SRP54_N (HMM E-Value=1.1) 72 3e-13 SB_33463| Best HMM Match : 7tm_1 (HMM E-Value=0) 28 4.7 >SB_385| Best HMM Match : SRP54_N (HMM E-Value=1.1) Length = 210 Score = 71.7 bits (168), Expect = 3e-13 Identities = 30/62 (48%), Positives = 48/62 (77%) Frame = +3 Query: 255 KKAKRPPTDEEIKKYVKQILEGANLEQITMKTVCKQVYSHYPDFDLAHKKDFIKATVKSC 434 K K+PPT++++ VK +L+ A+L+ +T+K++CK+VY+ YP+FDL+ +K FIK TV S Sbjct: 144 KLKKQPPTNDDLVTVVKDLLKDADLKVVTVKSICKEVYAKYPEFDLSDRKGFIKETVYSV 203 Query: 435 IS 440 IS Sbjct: 204 IS 205 >SB_33463| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 390 Score = 27.9 bits (59), Expect = 4.7 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = -3 Query: 428 FDCRLDEVLLVREIEIRIVAVNLFAHSLHRYLLQVGPLEDLLH 300 F C+L VL ++ + + ++L ++HRYL + PL+ LL+ Sbjct: 126 FLCKL--VLFIQGVSVSCSVLSLTVLAIHRYLSVMHPLKKLLN 166 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,115,468 Number of Sequences: 59808 Number of extensions: 202102 Number of successful extensions: 575 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 575 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1038380485 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -