BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_E08 (490 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 23 7.4 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 22 9.8 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 22.6 bits (46), Expect = 7.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 Query: 98 SGRCWRFPFDRRCFNVGVLSDRPFARLHDRRR 3 S R FPFDRR N GV S F + R Sbjct: 652 SRRAMGFPFDRRASN-GVRSVADFVAPYKNMR 682 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 22.2 bits (45), Expect = 9.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 311 DLLHVFLYLLVSGRPFCFLIRWR 243 D HVF+YL+ + F++R R Sbjct: 1605 DRAHVFIYLIREDQRVKFILRQR 1627 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 403,339 Number of Sequences: 2352 Number of extensions: 6617 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43131618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -