BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_E08 (490 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 23 2.3 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 3.1 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 3.1 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 4.0 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 4.0 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 7.0 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 7.0 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 7.0 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 22.6 bits (46), Expect = 2.3 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 Query: 316 SRICFTYFFISSSVGGRFAFLS 251 SRI F FF++ +V FA+LS Sbjct: 427 SRIVFPLFFLAINVFYWFAYLS 448 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.2 bits (45), Expect = 3.1 Identities = 13/55 (23%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = -3 Query: 425 DCRLDEVLLVREIEIRIVAVNLFAHSLHRYLLQV--GPLE-DLLHVFLYLLVSGR 270 +C+L+++LL + + N+ +H Y+L+ G + D + YL + G+ Sbjct: 245 NCKLNDILLTVRPHLELTFENILSHINTVYVLRTKKGVMRVDASEEYSYLRLKGQ 299 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.2 bits (45), Expect = 3.1 Identities = 13/55 (23%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = -3 Query: 425 DCRLDEVLLVREIEIRIVAVNLFAHSLHRYLLQV--GPLE-DLLHVFLYLLVSGR 270 +C+L+++LL + + N+ +H Y+L+ G + D + YL + G+ Sbjct: 245 NCKLNDILLTVRPHLELTFENILSHINTVYVLRTKKGVMRVDASEEYSYLRLKGQ 299 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.8 bits (44), Expect = 4.0 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = -2 Query: 360 VCTQSSSLSAPSWPPRGFASRISLSPRQWAAVLLSYPLARQ 238 +C +++ S + + SLS + AVL YPL R+ Sbjct: 523 ICLLTNARRVASVRAETYCNLFSLSVDHFNAVLDQYPLMRR 563 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.8 bits (44), Expect = 4.0 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = -2 Query: 360 VCTQSSSLSAPSWPPRGFASRISLSPRQWAAVLLSYPLARQ 238 +C +++ S + + SLS + AVL YPL R+ Sbjct: 491 ICLLTNARRVASVRAETYCNLFSLSVDHFNAVLDQYPLMRR 531 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.0 bits (42), Expect = 7.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 128 NSLWRWTLLLSGR 90 N LWRW L G+ Sbjct: 56 NGLWRWIRLTYGQ 68 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.0 bits (42), Expect = 7.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 128 NSLWRWTLLLSGR 90 N LWRW L G+ Sbjct: 94 NGLWRWIRLTYGQ 106 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.0 bits (42), Expect = 7.0 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 Query: 129 QQPLAVDPSSFR 94 QQP+ DPS F+ Sbjct: 982 QQPIMTDPSPFK 993 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,696 Number of Sequences: 438 Number of extensions: 1837 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13421061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -