BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_E01 (406 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U70852-4|AAK29816.2| 93|Caenorhabditis elegans Hypothetical pr... 26 9.0 AF022968-5|AAB69885.2| 1080|Caenorhabditis elegans Adenylyl cycl... 26 9.0 >U70852-4|AAK29816.2| 93|Caenorhabditis elegans Hypothetical protein F45E4.5 protein. Length = 93 Score = 26.2 bits (55), Expect = 9.0 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 198 WSSRRYSGPGHGF 236 W RYS PGHGF Sbjct: 40 WGRPRYSPPGHGF 52 >AF022968-5|AAB69885.2| 1080|Caenorhabditis elegans Adenylyl cyclase protein 2 protein. Length = 1080 Score = 26.2 bits (55), Expect = 9.0 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +2 Query: 206 PSLQWPRPRLWLKENNHS---LTFLCIFSCLYNHIFCIIY 316 P L WP R + N LTF+CI S N + C +Y Sbjct: 598 PKLLWPFSRKSITCNLSDCVLLTFVCIPSAFANLLLCSLY 637 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,574,922 Number of Sequences: 27780 Number of extensions: 148271 Number of successful extensions: 556 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 556 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 641068680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -