SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0002_E01
         (406 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U70852-4|AAK29816.2|   93|Caenorhabditis elegans Hypothetical pr...    26   9.0  
AF022968-5|AAB69885.2| 1080|Caenorhabditis elegans Adenylyl cycl...    26   9.0  

>U70852-4|AAK29816.2|   93|Caenorhabditis elegans Hypothetical
           protein F45E4.5 protein.
          Length = 93

 Score = 26.2 bits (55), Expect = 9.0
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 198 WSSRRYSGPGHGF 236
           W   RYS PGHGF
Sbjct: 40  WGRPRYSPPGHGF 52


>AF022968-5|AAB69885.2| 1080|Caenorhabditis elegans Adenylyl cyclase
           protein 2 protein.
          Length = 1080

 Score = 26.2 bits (55), Expect = 9.0
 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 3/40 (7%)
 Frame = +2

Query: 206 PSLQWPRPRLWLKENNHS---LTFLCIFSCLYNHIFCIIY 316
           P L WP  R  +  N      LTF+CI S   N + C +Y
Sbjct: 598 PKLLWPFSRKSITCNLSDCVLLTFVCIPSAFANLLLCSLY 637


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,574,922
Number of Sequences: 27780
Number of extensions: 148271
Number of successful extensions: 556
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 548
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 556
length of database: 12,740,198
effective HSP length: 74
effective length of database: 10,684,478
effective search space used: 641068680
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -