BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_D21 (284 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0844 + 11695159-11695263,11695402-11695463,11695789-116958... 25 7.1 03_02_0200 - 6360682-6362517,6362599-6362670 25 7.1 10_08_0858 - 21108283-21108387,21108820-21108889,21109490-211096... 25 9.4 10_08_0100 + 14788426-14789097 25 9.4 >03_02_0844 + 11695159-11695263,11695402-11695463,11695789-11695876, 11695958-11696019,11696250-11696346,11696592-11696984, 11697072-11697611,11697856-11697966,11698102-11698242, 11698290-11698394,11698480-11698557,11699346-11699472, 11699580-11699625,11699709-11699754 Length = 666 Score = 25.4 bits (53), Expect = 7.1 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 53 TPTTSLDFNAGWKKFDTP 106 T S+D NAGW FDTP Sbjct: 363 TAAPSMD-NAGWATFDTP 379 >03_02_0200 - 6360682-6362517,6362599-6362670 Length = 635 Score = 25.4 bits (53), Expect = 7.1 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 257 LKVYYYLCTKTYNSIYILKLI 195 L+ Y C+ +YN+I++ KLI Sbjct: 367 LEAENYACSSSYNAIFVKKLI 387 >10_08_0858 - 21108283-21108387,21108820-21108889,21109490-21109646, 21109930-21110062,21110409-21110583,21113353-21113453, 21113620-21113706,21115871-21115931,21116114-21116178, 21116534-21117631 Length = 683 Score = 25.0 bits (52), Expect = 9.4 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -1 Query: 263 IKLKVYYYLCTKTYNSIYILKLIFYKSQLKYC 168 +K+K Y+C ++ LK++F +Q K C Sbjct: 645 LKIKEVNYICYIYAEELHPLKVMFRNTQAKIC 676 >10_08_0100 + 14788426-14789097 Length = 223 Score = 25.0 bits (52), Expect = 9.4 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -2 Query: 148 KRKTGAGFPRGLNEWCIELLPTG 80 K T F G +EWC++ P G Sbjct: 47 KCATSPPFTAGGHEWCVDFYPNG 69 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,088,663 Number of Sequences: 37544 Number of extensions: 94296 Number of successful extensions: 198 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 195 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 198 length of database: 14,793,348 effective HSP length: 70 effective length of database: 12,165,268 effective search space used: 291966432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -