BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_D21 (284 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8164| Best HMM Match : rve (HMM E-Value=0.00069) 28 1.4 SB_909| Best HMM Match : Transgly_assoc (HMM E-Value=2.2) 25 9.8 >SB_8164| Best HMM Match : rve (HMM E-Value=0.00069) Length = 1117 Score = 27.9 bits (59), Expect = 1.4 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = -2 Query: 103 CIELLPTGVEVQRRGGRLEKIQFSAQRVVVAV 8 CI L+ T +V+RR +L + FSA+ V ++V Sbjct: 318 CIRLVNTRDDVKRRSEQLVNLAFSARHVGISV 349 >SB_909| Best HMM Match : Transgly_assoc (HMM E-Value=2.2) Length = 243 Score = 25.0 bits (52), Expect = 9.8 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 106 WCIELLPTGVEVQRRGGRLEKIQFS 32 WC+ + E QRR GR+ I F+ Sbjct: 102 WCLRDIDQSREKQRRRGRINNIFFA 126 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,012,168 Number of Sequences: 59808 Number of extensions: 109151 Number of successful extensions: 217 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 212 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 217 length of database: 16,821,457 effective HSP length: 70 effective length of database: 12,634,897 effective search space used: 303237528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -