BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_D17 (376 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3H1.06c |||membrane transporter |Schizosaccharomyces pombe|c... 29 0.24 SPAC1399.02 |||membrane transporter|Schizosaccharomyces pombe|ch... 28 0.42 SPBC1A4.03c |top2|ptr11|DNA topoisomerase II|Schizosaccharomyces... 26 1.7 SPBC3H7.03c |||2-oxoglutarate dehydrogenase |Schizosaccharomyces... 26 2.2 SPBC16G5.12c |top3||DNA topoisomerase III|Schizosaccharomyces po... 25 2.9 SPBC1604.13c |mrpl32||mitochondrial ribosomal protein subunit L3... 25 5.1 SPBC839.16 |||C-1-tetrahydrofolate synthase|Schizosaccharomyces ... 25 5.1 SPBC557.05 |||arrestin|Schizosaccharomyces pombe|chr 2|||Manual 24 9.0 SPBC2D10.18 |abc1|coq8|ABC1 kinase family protein|Schizosaccharo... 24 9.0 SPBC16G5.05c |||MSP domain|Schizosaccharomyces pombe|chr 2|||Manual 24 9.0 >SPAC3H1.06c |||membrane transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 589 Score = 29.1 bits (62), Expect = 0.24 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = -3 Query: 266 CILGFTLSACFISRTRAVKPSLCSDSLSSTGVVPNVFL 153 CI GF ++ + +RTR + PS +LS T V+ FL Sbjct: 325 CIAGFVVNEFYTTRTRIITPS-AFKTLSLTSVMVTSFL 361 >SPAC1399.02 |||membrane transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 589 Score = 28.3 bits (60), Expect = 0.42 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -3 Query: 266 CILGFTLSACFISRTRAVKPSLCSDSLSSTGVVPNVFL 153 CI GF ++ + +RTR + PS +LS + V+ FL Sbjct: 325 CIAGFVVNELYTTRTRIIAPS-AFQTLSLSSVMVTSFL 361 >SPBC1A4.03c |top2|ptr11|DNA topoisomerase II|Schizosaccharomyces pombe|chr 2|||Manual Length = 1485 Score = 26.2 bits (55), Expect = 1.7 Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 5/68 (7%) Frame = +1 Query: 184 DKESEHREG---FTALVRE--MKQALNVKPNMQLVISVLPNVNSSIYFDVPSIINLVDIV 348 D ES H EG F + E MK+ALN ++ +S ++ I FD I D V Sbjct: 985 DYESHHGEGNVHFNVTLTEAGMKEALNESLEVKFKLSRTQATSNMIAFDASGRIKKYDSV 1044 Query: 349 NIQAFDYY 372 ++Y Sbjct: 1045 EDILTEFY 1052 >SPBC3H7.03c |||2-oxoglutarate dehydrogenase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1009 Score = 25.8 bits (54), Expect = 2.2 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -2 Query: 348 DNVDQVYDAWDVKVNGAIYVWQ 283 D VD++YDAW N WQ Sbjct: 54 DYVDEMYDAWKKDPNSVHASWQ 75 >SPBC16G5.12c |top3||DNA topoisomerase III|Schizosaccharomyces pombe|chr 2|||Manual Length = 622 Score = 25.4 bits (53), Expect = 2.9 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 13 QARTAFTNSALLLAEQYGFDGIDLSWQLPK 102 Q T F S+L +A G+D I L W L K Sbjct: 531 QGVTEFVPSSLGVALAKGYDEIGLEWSLTK 560 >SPBC1604.13c |mrpl32||mitochondrial ribosomal protein subunit L32|Schizosaccharomyces pombe|chr 2|||Manual Length = 103 Score = 24.6 bits (51), Expect = 5.1 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 217 ALVREMKQALNVKPNMQLVISVLPNVNSSIYFDVPSIINL 336 AL+R A++ K S LP+++ I+ PSI N+ Sbjct: 2 ALLRGNSLAISQKMLSVFQASALPHISLRIFISPPSIANI 41 >SPBC839.16 |||C-1-tetrahydrofolate synthase|Schizosaccharomyces pombe|chr 2|||Manual Length = 937 Score = 24.6 bits (51), Expect = 5.1 Identities = 26/108 (24%), Positives = 45/108 (41%), Gaps = 4/108 (3%) Frame = +1 Query: 43 LLLAEQYGFDGIDLSWQLPKRKPKKIRSSIGSFWHSIKKTFGTTPVDDKESEHREGFTAL 222 ++ E YG DGI+LS +R + + I KT + D FT Sbjct: 831 IIAKEMYGADGIELSPLAKERLETFTKQGYNNLPICIAKTQYSLSHDPDLKGAPTNFTVP 890 Query: 223 VREMKQALN---VKPNMQLVISVLPNV-NSSIYFDVPSIINLVDIVNI 354 +R+M+ + + P + IS +P + Y+++ I DIV + Sbjct: 891 IRDMRLSAGAGFIYP-LAAAISTIPGLPTKPAYYNI-DIAENGDIVGL 936 >SPBC557.05 |||arrestin|Schizosaccharomyces pombe|chr 2|||Manual Length = 433 Score = 23.8 bits (49), Expect = 9.0 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 Query: 274 ISVLPNVNSSIYFDVPSII 330 I+VLP+++ S + D PSI+ Sbjct: 191 INVLPSISPSSFLDSPSIM 209 >SPBC2D10.18 |abc1|coq8|ABC1 kinase family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 610 Score = 23.8 bits (49), Expect = 9.0 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 4 ESPQARTAFTNSALLLAEQYGFDGIDL 84 ES Q A NS LAE + FD D+ Sbjct: 517 ESAQMIDAHINSIFTLAEPFAFDAPDV 543 >SPBC16G5.05c |||MSP domain|Schizosaccharomyces pombe|chr 2|||Manual Length = 383 Score = 23.8 bits (49), Expect = 9.0 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 8/43 (18%) Frame = -3 Query: 215 VKPSLCSDSLSSTG--------VVPNVFLMLCQKDPILERIFF 111 +KPS +D SSTG + PN+ ++LC ++ +FF Sbjct: 341 IKPSYSADPSSSTGASLTESPGIPPNIVIILCLIFFLIGYLFF 383 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,367,627 Number of Sequences: 5004 Number of extensions: 25185 Number of successful extensions: 88 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 87 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 88 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 120195862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -