BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_D13 (500 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 24 1.0 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 24 1.0 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 23 2.4 DQ435335-1|ABD92650.1| 135|Apis mellifera OBP18 protein. 21 5.5 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 7.2 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.8 bits (49), Expect = 1.0 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 211 SFTGNTDCEL*DRHTTACRSGLLLQKDHTDDFPLLSGFR 327 SFT + ++ T +GLLL++ DD P L R Sbjct: 453 SFTVDKLITYFEQFDTTINNGLLLEEQRNDDKPFLIKIR 491 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.8 bits (49), Expect = 1.0 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 211 SFTGNTDCEL*DRHTTACRSGLLLQKDHTDDFPLLSGFR 327 SFT + ++ T +GLLL++ DD P L R Sbjct: 453 SFTVDKLITYFEQFDTTINNGLLLEEQRNDDKPFLIKIR 491 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 22.6 bits (46), Expect = 2.4 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 362 DEPIRNLASHVLRNPDRSGKSS 297 D+ + +LA+H + RSGK S Sbjct: 354 DDLLNDLAAHKMHGRGRSGKKS 375 >DQ435335-1|ABD92650.1| 135|Apis mellifera OBP18 protein. Length = 135 Score = 21.4 bits (43), Expect = 5.5 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 Query: 221 VIPIVNCETAIPQPVAQDF 277 V+PI ET+I Q DF Sbjct: 29 VVPICRIETSIDQQKEDDF 47 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.0 bits (42), Expect = 7.2 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -2 Query: 271 LSDRLWYGGLTVHNRYY 221 +++ L+Y LT H+ YY Sbjct: 262 VTNNLYYSPLTSHSLYY 278 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,430 Number of Sequences: 438 Number of extensions: 2549 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13741392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -