BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_D07 (467 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z93386-1|CAB07645.1| 442|Caenorhabditis elegans Hypothetical pr... 31 0.31 AF067608-13|AAK95862.1| 1634|Caenorhabditis elegans Hypothetical... 30 0.95 U55376-1|AAA98003.1| 434|Caenorhabditis elegans Hypothetical pr... 28 2.9 U23516-9|AAG38884.1| 1203|Caenorhabditis elegans Hypothetical pr... 28 3.8 AF016425-6|AAY86242.1| 104|Caenorhabditis elegans Hypothetical ... 27 5.1 AF016655-6|AAK31436.1| 257|Caenorhabditis elegans Hypothetical ... 27 6.7 AC024856-1|ABB51172.1| 334|Caenorhabditis elegans Hypothetical ... 27 6.7 >Z93386-1|CAB07645.1| 442|Caenorhabditis elegans Hypothetical protein R11H6.2 protein. Length = 442 Score = 31.5 bits (68), Expect = 0.31 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = -3 Query: 189 TGGTIRVDSESTRLPAHPRVSPLLRLILILFDVVTRLFNKHVTAVDADQE 40 TGG + DS T LP H +S L+ LI +++ + N + + D E Sbjct: 301 TGGVTKDDSFVTPLPVHSLISLLIWLICLVYASIRNSSNTSLGKITGDNE 350 >AF067608-13|AAK95862.1| 1634|Caenorhabditis elegans Hypothetical protein B0511.12 protein. Length = 1634 Score = 29.9 bits (64), Expect = 0.95 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 135 RVSPLLRLILILFDVVTRLFNKHVTAVDADQE 40 R+S L++ILFD++T F KH+ + D++ Sbjct: 416 RMSSNQNLMVILFDIITSPFRKHLDSEQEDED 447 >U55376-1|AAA98003.1| 434|Caenorhabditis elegans Hypothetical protein F16H11.3 protein. Length = 434 Score = 28.3 bits (60), Expect = 2.9 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -1 Query: 248 EPRALSLWFSLPVMGTLTIAPEVPSELI 165 +P + W+S MG+LTIA ++P+ I Sbjct: 57 KPDGVETWYSKEFMGSLTIASQLPNASI 84 >U23516-9|AAG38884.1| 1203|Caenorhabditis elegans Hypothetical protein B0416.1 protein. Length = 1203 Score = 27.9 bits (59), Expect = 3.8 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = -3 Query: 234 ELVVFIASYGYLDHSTGGTIRVDSESTRLPAHPRVSPLLRLILIL 100 + V + S +DHSTG DSEST P++S R ++ + Sbjct: 876 QFVPSLGSVSEVDHSTGEEQSSDSESTTSSLPPKLSLRQRFLVCI 920 >AF016425-6|AAY86242.1| 104|Caenorhabditis elegans Hypothetical protein F59A7.11 protein. Length = 104 Score = 27.5 bits (58), Expect = 5.1 Identities = 15/53 (28%), Positives = 25/53 (47%) Frame = +1 Query: 28 LVSVLLVGVNSRYVLVEEPGYYIEQYEDQPEQWANSRVRRQAGALTINSDGTS 186 L++ LL + V+ PG + ED + R RR G T+ +DG++ Sbjct: 4 LINSLLFTIAILAVVWGYPGQQADHVEDLTKNRNEPRARRDLGTETVRADGSA 56 >AF016655-6|AAK31436.1| 257|Caenorhabditis elegans Hypothetical protein C17F4.3 protein. Length = 257 Score = 27.1 bits (57), Expect = 6.7 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +1 Query: 226 HKLSALGSVDLTNQMKLGAATAGLAYDNVNGHGANLTK 339 H +SA+ + DL++ AG+A + VNGHG N+ K Sbjct: 92 HMVSAVYAEDLSDGWG-----AGMAVNGVNGHGLNVRK 124 >AC024856-1|ABB51172.1| 334|Caenorhabditis elegans Hypothetical protein Y71G10AR.4 protein. Length = 334 Score = 27.1 bits (57), Expect = 6.7 Identities = 10/27 (37%), Positives = 20/27 (74%) Frame = -1 Query: 269 IWLVRSTEPRALSLWFSLPVMGTLTIA 189 +W+VRS E R L+++F + V+ +++A Sbjct: 169 VWVVRSKESRRLTVYFVISVVVLISMA 195 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,518,708 Number of Sequences: 27780 Number of extensions: 205995 Number of successful extensions: 512 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 505 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 512 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 839684522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -