BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_D06 (495 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5MGH6 Cluster: Protease inhibitor 1; n=1; Lonomia obli... 95 8e-19 UniRef50_Q2F5I4 Cluster: Protease inhibitor 1; n=1; Bombyx mori|... 84 1e-15 UniRef50_Q0Q016 Cluster: Protease inhibitor-like protein; n=2; A... 79 7e-14 UniRef50_Q0Q013 Cluster: Protease inhibitor-like protein; n=1; A... 77 2e-13 UniRef50_UPI000051A47D Cluster: PREDICTED: similar to CG1220-PE,... 59 5e-08 UniRef50_Q5TWF3 Cluster: ENSANGP00000028615; n=1; Anopheles gamb... 54 1e-06 UniRef50_O97042 Cluster: KAZ1-type serine protease inhibitor-lik... 53 4e-06 UniRef50_Q29ER1 Cluster: GA17247-PA; n=1; Drosophila pseudoobscu... 52 7e-06 UniRef50_O97040 Cluster: Protease inhibitor-like protein; n=1; D... 50 4e-05 UniRef50_Q16IM9 Cluster: Putative uncharacterized protein; n=2; ... 49 5e-05 UniRef50_A1X5G1 Cluster: Serine protease inhibitor-1L; n=2; Chla... 47 2e-04 UniRef50_Q2MGM1 Cluster: CG34018-PA; n=4; Drosophila melanogaste... 46 5e-04 UniRef50_UPI00015B5FDB Cluster: PREDICTED: hypothetical protein;... 46 6e-04 UniRef50_Q5TWF4 Cluster: ENSANGP00000029160; n=1; Anopheles gamb... 45 0.001 UniRef50_Q32TF4 Cluster: Serine protease inhibitor; n=2; Argopec... 45 0.001 UniRef50_UPI00015B5CDE Cluster: PREDICTED: similar to protease i... 44 0.002 UniRef50_Q6WVJ7 Cluster: Hemocyte kazal-type proteinase inhibito... 43 0.004 UniRef50_A7SCV8 Cluster: Predicted protein; n=1; Nematostella ve... 42 0.008 UniRef50_Q92033 Cluster: Vitellogenin; n=3; Anolis pulchellus|Re... 42 0.010 UniRef50_Q8MZJ9 Cluster: Serine proteinase inhibitor PI-S; n=1; ... 40 0.023 UniRef50_A7S7B8 Cluster: Predicted protein; n=1; Nematostella ve... 40 0.031 UniRef50_UPI0000DB79FF Cluster: PREDICTED: similar to CG2264-PA,... 39 0.071 UniRef50_Q8T7L6 Cluster: Silk proteinase inhibitor; n=1; Bombyx ... 39 0.071 UniRef50_Q8IPA4 Cluster: CG31704-PA; n=2; Sophophora|Rep: CG3170... 39 0.071 UniRef50_Q0Q012 Cluster: Protease inhibitor-like protein; n=1; A... 38 0.093 UniRef50_Q45TK1 Cluster: Mantle protein 9; n=1; Pinctada fucata|... 38 0.12 UniRef50_UPI00015B5FDA Cluster: PREDICTED: similar to hepatopanc... 38 0.16 UniRef50_A7T5U4 Cluster: Predicted protein; n=1; Nematostella ve... 37 0.22 UniRef50_UPI0000D569D0 Cluster: PREDICTED: similar to CG32354-PA... 37 0.28 UniRef50_Q21157 Cluster: Putative uncharacterized protein; n=2; ... 37 0.28 UniRef50_P84755 Cluster: Protease inhibitor 2; n=1; Cenchritis m... 37 0.28 UniRef50_UPI0000E47F76 Cluster: PREDICTED: similar to hepatopanc... 36 0.38 UniRef50_O13274 Cluster: Sperm-activating protein; n=2; Clupea p... 36 0.38 UniRef50_Q7PWH1 Cluster: ENSANGP00000019497; n=1; Anopheles gamb... 36 0.38 UniRef50_Q0Q009 Cluster: Protease inhibitor-like protein; n=1; A... 36 0.38 UniRef50_A7S1Y8 Cluster: Predicted protein; n=1; Nematostella ve... 36 0.38 UniRef50_UPI00015B502F Cluster: PREDICTED: similar to CG2264A; n... 36 0.50 UniRef50_Q6V4H5 Cluster: Serine proteinase inhibitor; n=2; Astac... 36 0.50 UniRef50_P82968 Cluster: Protease inhibitor; n=3; Eumetazoa|Rep:... 36 0.50 UniRef50_UPI0000E4884D Cluster: PREDICTED: similar to mucin 17; ... 36 0.66 UniRef50_Q5CKD2 Cluster: T13C2.5; n=2; Cryptosporidium|Rep: T13C... 36 0.66 UniRef50_A7S7E2 Cluster: Predicted protein; n=1; Nematostella ve... 36 0.66 UniRef50_O00468 Cluster: Agrin precursor; n=41; Euteleostomi|Rep... 36 0.66 UniRef50_Q4SCB6 Cluster: Chromosome undetermined SCAF14659, whol... 35 0.87 UniRef50_Q9VSK1 Cluster: CG32354-PA; n=4; Diptera|Rep: CG32354-P... 35 0.87 UniRef50_Q177V9 Cluster: Putative uncharacterized protein; n=1; ... 35 0.87 UniRef50_Q6MZW2 Cluster: Follistatin-related protein 4 precursor... 35 0.87 UniRef50_UPI00005472E7 Cluster: PREDICTED: similar to Elastase i... 35 1.1 UniRef50_Q6PQG3 Cluster: Kazal-like serine protease inhibitor EP... 35 1.1 UniRef50_Q5TVI8 Cluster: ENSANGP00000026934; n=1; Anopheles gamb... 35 1.1 UniRef50_Q1XEF1 Cluster: Putative serine protease inhibitor; n=1... 35 1.1 UniRef50_Q16N95 Cluster: Secreted modular calcium-binding protei... 35 1.1 UniRef50_Q0Q008 Cluster: Protease inhibitor-like protein; n=1; A... 35 1.1 UniRef50_A7RRU4 Cluster: Predicted protein; n=1; Nematostella ve... 35 1.1 UniRef50_A0NC57 Cluster: ENSANGP00000029787; n=1; Anopheles gamb... 35 1.1 UniRef50_P23499 Cluster: SPARC-like protein 1 precursor; n=6; Gn... 35 1.1 UniRef50_UPI0000D99687 Cluster: PREDICTED: similar to agrin; n=1... 34 1.5 UniRef50_UPI000051A338 Cluster: PREDICTED: similar to agrin isof... 34 1.5 UniRef50_Q9NQ38 Cluster: Serine protease inhibitor Kazal-type 5 ... 34 1.5 UniRef50_Q4RSP1 Cluster: Chromosome 12 SCAF14999, whole genome s... 34 2.0 UniRef50_Q6WVJ6 Cluster: Hepatopancreas kazal-type proteinase in... 34 2.0 UniRef50_Q16PW6 Cluster: Putative uncharacterized protein; n=1; ... 34 2.0 UniRef50_Q5DT21 Cluster: Serine protease inhibitor Kazal type 9;... 34 2.0 UniRef50_UPI0000E474D2 Cluster: PREDICTED: similar to agrin; n=1... 33 2.7 UniRef50_Q0BYE4 Cluster: Kazal domain protein; n=1; Hyphomonas n... 33 2.7 UniRef50_Q6PQG4 Cluster: Kazal-like serine protease inhibitor EP... 33 2.7 UniRef50_Q6PPA1 Cluster: Kazal-like serine protease inhibitor Pb... 33 2.7 UniRef50_A7S7E5 Cluster: Predicted protein; n=1; Nematostella ve... 33 2.7 UniRef50_P00998 Cluster: Pancreatic secretory trypsin inhibitor;... 33 2.7 UniRef50_P19883 Cluster: Follistatin precursor; n=57; Vertebrata... 33 2.7 UniRef50_UPI0000E2041C Cluster: PREDICTED: similar to Serine pro... 33 3.5 UniRef50_Q82V56 Cluster: Kazal-type serine protease inhibitor do... 33 3.5 UniRef50_Q6PQG2 Cluster: Kazal-like serine protease inhibitor EP... 33 3.5 UniRef50_Q7Q348 Cluster: ENSANGP00000014954; n=1; Anopheles gamb... 33 3.5 UniRef50_Q7PP79 Cluster: ENSANGP00000013791; n=1; Anopheles gamb... 33 3.5 UniRef50_A7SCV7 Cluster: Predicted protein; n=1; Nematostella ve... 33 3.5 UniRef50_A7S1Y9 Cluster: Predicted protein; n=1; Nematostella ve... 33 3.5 UniRef50_P20155 Cluster: Serine protease inhibitor Kazal-type 2 ... 33 3.5 UniRef50_O96790 Cluster: Serine protease inhibitor dipetalogasti... 33 3.5 UniRef50_Q0ASJ9 Cluster: Proteinase inhibitor I1, Kazal precurso... 33 4.6 UniRef50_A7RI85 Cluster: Predicted protein; n=1; Nematostella ve... 33 4.6 UniRef50_A7DZ96 Cluster: AGRin (Synaptic protein) homolog family... 33 4.6 UniRef50_UPI00015555AF Cluster: PREDICTED: similar to serine pro... 32 6.1 UniRef50_Q6PVV6 Cluster: SPARCL1; n=3; Danio rerio|Rep: SPARCL1 ... 32 6.1 UniRef50_Q9VYH8 Cluster: CG15721-PA; n=1; Drosophila melanogaste... 32 6.1 UniRef50_Q9N9H5 Cluster: Guanylyl cyclase; n=3; Plasmodium falci... 32 6.1 UniRef50_Q5CQH1 Cluster: Extracellular protein with a signal pep... 32 6.1 UniRef50_Q1EF71 Cluster: Male reproductive tract-specific Kazal-... 32 6.1 UniRef50_O62054 Cluster: Putative uncharacterized protein; n=1; ... 32 6.1 UniRef50_A4QPC2 Cluster: SLCO5A1 protein; n=2; Homo/Pan/Gorilla ... 32 6.1 UniRef50_Q6C3Z4 Cluster: Similar to sp|P27514 Saccharomyces cere... 32 6.1 UniRef50_Q4WAD7 Cluster: Integral membrane protein; n=6; Trichoc... 32 6.1 UniRef50_Q9H2Y9 Cluster: Solute carrier organic anion transporte... 32 6.1 UniRef50_A7MBT7 Cluster: Putative uncharacterized protein; n=2; ... 32 8.1 UniRef50_Q968S7 Cluster: Silk protease inhibitor 2 precursor; n=... 32 8.1 UniRef50_Q5CY32 Cluster: Putative uncharacterized protein; n=2; ... 32 8.1 UniRef50_A7T1D7 Cluster: Predicted protein; n=1; Nematostella ve... 32 8.1 UniRef50_A7SIW2 Cluster: Predicted protein; n=2; Nematostella ve... 32 8.1 UniRef50_P08481 Cluster: Double-headed protease inhibitor, subma... 32 8.1 >UniRef50_Q5MGH6 Cluster: Protease inhibitor 1; n=1; Lonomia obliqua|Rep: Protease inhibitor 1 - Lonomia obliqua (Moth) Length = 155 Score = 95.1 bits (226), Expect = 8e-19 Identities = 48/110 (43%), Positives = 59/110 (53%), Gaps = 4/110 (3%) Frame = +1 Query: 25 PIQNGYRIQYPLDNNYNFIAFIFPNQVQFPNQTPLXXXXXXXXXXXXXXXRQTI----EK 192 PIQN + Q P D+N N F NQ Q NQ Q ++ Sbjct: 42 PIQNVFPEQNPFDDNMNIDIIDFLNQAQIGNQGQTNQQQQTSSTTLAPNNGQVAASMQQQ 101 Query: 193 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPCPSSS 342 C NC T EYNPVCG+DN TY N GRL CAQ+CG+ V+LARQ+PCP ++ Sbjct: 102 CIRNCPVTSEYNPVCGTDNVTYTNPGRLTCAQSCGINVSLARQSPCPRAN 151 >UniRef50_Q2F5I4 Cluster: Protease inhibitor 1; n=1; Bombyx mori|Rep: Protease inhibitor 1 - Bombyx mori (Silk moth) Length = 148 Score = 84.2 bits (199), Expect = 1e-15 Identities = 37/90 (41%), Positives = 49/90 (54%) Frame = +1 Query: 76 FIAFIFPNQVQFPNQTPLXXXXXXXXXXXXXXXRQTIEKCAENCISTPEYNPVCGSDNKT 255 F +FP Q QFP Q I++C +C T EYNPVCG+DN T Sbjct: 55 FFPGLFPGQGQFPGQQQRLTTTRAPNNLGTTTMSPAIQQCIRSCPVTAEYNPVCGTDNIT 114 Query: 256 YKNQGRLFCAQNCGVKVTLARQAPCPSSSK 345 Y N GRL CAQ CG+ V++ R PCP++++ Sbjct: 115 YNNPGRLTCAQACGINVSVLRSLPCPTATQ 144 >UniRef50_Q0Q016 Cluster: Protease inhibitor-like protein; n=2; Antheraea mylitta|Rep: Protease inhibitor-like protein - Antheraea mylitta (Tasar silkworm) Length = 99 Score = 78.6 bits (185), Expect = 7e-14 Identities = 30/51 (58%), Positives = 40/51 (78%) Frame = +1 Query: 181 TIEKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPCP 333 ++++C +C TPEYNPVCG++N+T+ N GRL CAQ CG V LAR+APCP Sbjct: 44 SLDECKRSCPVTPEYNPVCGTNNETFSNPGRLICAQACGENVKLARRAPCP 94 >UniRef50_Q0Q013 Cluster: Protease inhibitor-like protein; n=1; Antheraea mylitta|Rep: Protease inhibitor-like protein - Antheraea mylitta (Tasar silkworm) Length = 132 Score = 77.4 bits (182), Expect = 2e-13 Identities = 38/85 (44%), Positives = 46/85 (54%), Gaps = 4/85 (4%) Frame = +1 Query: 91 FPNQVQFPNQTPLXXXXXXXXXXXXXXXRQ----TIEKCAENCISTPEYNPVCGSDNKTY 258 FPNQ QF NQ ++++C +C T EYNPVCG+DN TY Sbjct: 43 FPNQQQFLNQQQFLNQQQQTPRTTAAANNGGTTLSLDECKRSCPVTSEYNPVCGTDNITY 102 Query: 259 KNQGRLFCAQNCGVKVTLARQAPCP 333 N GRL CAQ CG V LA++APCP Sbjct: 103 TNHGRLTCAQACGENVKLAKRAPCP 127 >UniRef50_UPI000051A47D Cluster: PREDICTED: similar to CG1220-PE, isoform E; n=1; Apis mellifera|Rep: PREDICTED: similar to CG1220-PE, isoform E - Apis mellifera Length = 131 Score = 59.3 bits (137), Expect = 5e-08 Identities = 24/51 (47%), Positives = 32/51 (62%) Frame = +1 Query: 187 EKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPCPSS 339 ++C C +T EYNPVCGSD YKN G+L CA CG V+L+ C ++ Sbjct: 76 DQCVATCRTTNEYNPVCGSDQIDYKNPGQLSCASMCGKDVSLSHYGRCTTT 126 >UniRef50_Q5TWF3 Cluster: ENSANGP00000028615; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000028615 - Anopheles gambiae str. PEST Length = 164 Score = 54.4 bits (125), Expect = 1e-06 Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 2/48 (4%) Frame = +1 Query: 193 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVK--VTLARQAPC 330 C NC++ +YNPVCG+D+ TY N+ +L CA CG K V++ + C Sbjct: 117 CMSNCLTLSQYNPVCGTDHTTYHNEYKLECANRCGAKPRVSIKKSGIC 164 >UniRef50_O97042 Cluster: KAZ1-type serine protease inhibitor-like protein type epsilon; n=4; Drosophila melanogaster|Rep: KAZ1-type serine protease inhibitor-like protein type epsilon - Drosophila melanogaster (Fruit fly) Length = 115 Score = 52.8 bits (121), Expect = 4e-06 Identities = 19/36 (52%), Positives = 25/36 (69%) Frame = +1 Query: 193 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGV 300 C +C +T EYNP+CGSDN Y N+ + CA NCG+ Sbjct: 67 CFHSCPATSEYNPICGSDNVNYYNENKFNCALNCGL 102 >UniRef50_Q29ER1 Cluster: GA17247-PA; n=1; Drosophila pseudoobscura|Rep: GA17247-PA - Drosophila pseudoobscura (Fruit fly) Length = 96 Score = 52.0 bits (119), Expect = 7e-06 Identities = 19/35 (54%), Positives = 24/35 (68%) Frame = +1 Query: 193 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCG 297 C ++C +T EYNP+CGSDN Y N G+ CA CG Sbjct: 58 CLQSCPATSEYNPICGSDNVNYYNGGKFDCAVRCG 92 >UniRef50_O97040 Cluster: Protease inhibitor-like protein; n=1; Drosophila melanogaster|Rep: Protease inhibitor-like protein - Drosophila melanogaster (Fruit fly) Length = 103 Score = 49.6 bits (113), Expect = 4e-05 Identities = 18/37 (48%), Positives = 27/37 (72%) Frame = +1 Query: 190 KCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGV 300 +C ++C++TPEYNPV SD +Y N+ +L CA CG+ Sbjct: 51 QCTQSCLTTPEYNPVWSSDMVSYDNKSKLNCAIKCGL 87 >UniRef50_Q16IM9 Cluster: Putative uncharacterized protein; n=2; Aedes aegypti|Rep: Putative uncharacterized protein - Aedes aegypti (Yellowfever mosquito) Length = 146 Score = 49.2 bits (112), Expect = 5e-05 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = +1 Query: 193 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAP 327 C NC++ YNPVCG+D+ TY N +L C+ CG + + + P Sbjct: 99 CMTNCLTLSHYNPVCGTDHTTYHNVYKLECSNRCGARPRVQVRKP 143 >UniRef50_A1X5G1 Cluster: Serine protease inhibitor-1L; n=2; Chlamys farreri|Rep: Serine protease inhibitor-1L - Chlamys farreri Length = 508 Score = 47.2 bits (107), Expect = 2e-04 Identities = 22/49 (44%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +1 Query: 190 KCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNC-GVKVTLARQAPCP 333 +C C T EYNPVCGSD TY N C C GV + ++ PCP Sbjct: 344 ECPCGCACTKEYNPVCGSDGNTYGNP----CMAKCQGVAIQCKQRCPCP 388 Score = 45.6 bits (103), Expect = 6e-04 Identities = 22/52 (42%), Positives = 28/52 (53%) Frame = +1 Query: 178 QTIEKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPCP 333 Q KC +CI T EY PVCG+D TY N F + GV + ++ PCP Sbjct: 259 QCAGKCPCDCICTLEYAPVCGTDGNTYGN--ACFATKCHGVGIECKQKCPCP 308 Score = 44.8 bits (101), Expect = 0.001 Identities = 22/47 (46%), Positives = 26/47 (55%) Frame = +1 Query: 190 KCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPC 330 KC CI T ++NPVCG D K Y N+ CA GV V A + PC Sbjct: 223 KCPCPCICTADFNPVCGVDGKPYSNKCLAGCA---GVDVQCAGKCPC 266 Score = 43.6 bits (98), Expect = 0.002 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 184 IEKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNC-GVKVTLARQAPCP 333 I KC +CI T +++PVCG D +TY N C C GV + PCP Sbjct: 100 IGKCPCDCICTQQFDPVCGVDGETYGNA----CVAGCHGVAIDCKGTCPCP 146 Score = 43.6 bits (98), Expect = 0.002 Identities = 20/48 (41%), Positives = 27/48 (56%) Frame = +1 Query: 190 KCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPCP 333 KC C+ T +Y+PVCG+D K Y N+ F + GV V + PCP Sbjct: 182 KCPCECVCTLQYDPVCGTDGKNYGNE--CFPIKCHGVGVACKGKCPCP 227 Score = 41.5 bits (93), Expect = 0.010 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +1 Query: 178 QTIEKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNC-GVKVTLARQAPC 330 Q ++C CI T E+ PVCG+D +TY N+ C C V V A + PC Sbjct: 380 QCKQRCPCPCICTEEFQPVCGADGETYDNK----CFAACENVPVACAGRCPC 427 Score = 39.1 bits (87), Expect = 0.053 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +1 Query: 199 ENCISTPEYNPVCGSDNKTYKNQGRLFCAQNC-GVKVTLARQAPC 330 ++C+ +Y PVCG D KTY N C C GV V + PC Sbjct: 65 DDCVCQQDYTPVCGVDGKTYSND----CFAGCKGVAVACIGKCPC 105 Score = 38.3 bits (85), Expect = 0.093 Identities = 19/46 (41%), Positives = 23/46 (50%) Frame = +1 Query: 193 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPC 330 C CI ++NPVCG+DN TY N CA V V + PC Sbjct: 143 CPCPCIIDLQFNPVCGADNVTYSNPRAAKCA---NVPVNCLGKCPC 185 Score = 37.5 bits (83), Expect = 0.16 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +1 Query: 190 KCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNC-GVKVTLARQAPCP 333 +C NC Y PVCG + +TY N C C G+ V + PCP Sbjct: 424 RCPCNCHCPKIYKPVCGKNGETYGNA----CVAKCLGISVRCEGKCPCP 468 Score = 33.1 bits (72), Expect = 3.5 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +1 Query: 187 EKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPC 330 +KC C + PVCG D KTY + C + V V A + PC Sbjct: 303 QKCPCPCFCPAVFIPVCGVDGKTYGSACEAACEK---VPVACAGECPC 347 >UniRef50_Q2MGM1 Cluster: CG34018-PA; n=4; Drosophila melanogaster|Rep: CG34018-PA - Drosophila melanogaster (Fruit fly) Length = 423 Score = 46.0 bits (104), Expect = 5e-04 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = +1 Query: 193 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKV 306 C NC +T +YNP+CGS+ + Y N+ + CA+ CG + Sbjct: 232 CFGNCPTTSQYNPICGSNMQLYMNEEKFNCARFCGAAI 269 >UniRef50_UPI00015B5FDB Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 85 Score = 45.6 bits (103), Expect = 6e-04 Identities = 24/54 (44%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = +1 Query: 184 IEKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLA--RQAPCPSS 339 +E C CIST EY P+C S+ TY N L CA+ C + LA R CP S Sbjct: 29 LENC--QCISTFEYLPLCASNGVTYSNPSMLECAKKCLGRTDLAKVRDGACPES 80 >UniRef50_Q5TWF4 Cluster: ENSANGP00000029160; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000029160 - Anopheles gambiae str. PEST Length = 716 Score = 44.8 bits (101), Expect = 0.001 Identities = 17/36 (47%), Positives = 24/36 (66%) Frame = +1 Query: 190 KCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCG 297 +C N ++ Y PVCG+D TY N+G+L CA+ CG Sbjct: 663 RCIRNTVAQA-YEPVCGTDGVTYSNRGKLRCARTCG 697 >UniRef50_Q32TF4 Cluster: Serine protease inhibitor; n=2; Argopecten irradians|Rep: Serine protease inhibitor - Aequipecten irradians (Bay scallop) (Argopecten irradians) Length = 278 Score = 44.8 bits (101), Expect = 0.001 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +1 Query: 193 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNC-GVKVTLARQAPC 330 C +C T ++NPVCG D KTY N+ C+ C GV+V + PC Sbjct: 230 CRNSCACTLDFNPVCGHDGKTYPNR----CSAECKGVRVRCPWECPC 272 Score = 41.1 bits (92), Expect = 0.013 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +1 Query: 193 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNC-GVKVTLARQAPCPSS 339 C +C+ ++PVCG++ KTY N+ CA C GV V PC +S Sbjct: 188 CKSSCVCPLNFSPVCGTNGKTYSNK----CAAGCKGVPVKCTGACPCRNS 233 Score = 40.7 bits (91), Expect = 0.018 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +1 Query: 199 ENCISTPEYNPVCGSDNKTYKNQGRLFCAQNC-GVKVTLARQAPC 330 E C+ Y+PVCG D KTY N C+ C VK+ R+ PC Sbjct: 105 EQCVCPSIYSPVCGYDGKTYSNA----CSAGCDNVKIRCNRKCPC 145 Score = 39.1 bits (87), Expect = 0.053 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 202 NCISTPEYNPVCGSDNKTYKNQGRLFCAQNC-GVKVTLARQAPC 330 +CI T EY PVCG++ KTY N+ C C +V + PC Sbjct: 63 SCICTREYQPVCGTNGKTYSNK----CVAKCNNARVRCQGKCPC 102 Score = 35.9 bits (79), Expect = 0.50 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 205 CISTPEYNPVCGSDNKTYKNQGRLFCAQNC-GVKVTLARQAPCPSS 339 C+ T +PVCGSD + Y N C C G V + PC SS Sbjct: 150 CVCTKHLDPVCGSDGRNYGNP----CMAKCKGATVRCKGKCPCKSS 191 >UniRef50_UPI00015B5CDE Cluster: PREDICTED: similar to protease inhibitor 1; n=2; Nasonia vitripennis|Rep: PREDICTED: similar to protease inhibitor 1 - Nasonia vitripennis Length = 81 Score = 44.0 bits (99), Expect = 0.002 Identities = 19/43 (44%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +1 Query: 205 CISTPEYNPVCGSDNKTYKNQGRLFCAQNC-GVKVTLARQAPC 330 C T EY PVCG+DN TY N +L C C G +T+ C Sbjct: 32 CKVTKEYKPVCGTDNHTYDNWRKLACKNKCEGTNITVNYNGVC 74 >UniRef50_Q6WVJ7 Cluster: Hemocyte kazal-type proteinase inhibitor; n=2; Penaeidae|Rep: Hemocyte kazal-type proteinase inhibitor - Penaeus monodon (Penoeid shrimp) Length = 271 Score = 42.7 bits (96), Expect = 0.004 Identities = 22/50 (44%), Positives = 28/50 (56%) Frame = +1 Query: 184 IEKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPCP 333 I CA++C + +PVCGSD KTY ++ L A GV VT PCP Sbjct: 26 IRLCAKHCTTI---SPVCGSDGKTYDSRCHLENAACGGVSVTFHHAGPCP 72 Score = 33.1 bits (72), Expect = 3.5 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +1 Query: 190 KCAENCISTPEYNPVCGSDNKTYKN 264 +C N + T EY PVCGS+ TY N Sbjct: 214 RCECNHVCTEEYYPVCGSNGVTYSN 238 >UniRef50_A7SCV8 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 244 Score = 41.9 bits (94), Expect = 0.008 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = +1 Query: 190 KCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNC--GVKVTLARQAPCP 333 +C + C T EY P CG+D TY N+ + Q+C G K+ LA PCP Sbjct: 114 ECPKAC--TREYKPACGTDGNTYPNR-CVLAIQSCETGEKLQLAHDGPCP 160 Score = 39.9 bits (89), Expect = 0.031 Identities = 20/45 (44%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = +1 Query: 208 ISTPEYNPVCGSDNKTYKNQGRL---FCAQNCGVKVTLARQAPCP 333 + T +Y PVCGSDNKTY N L C K+ L PCP Sbjct: 66 VCTLDYTPVCGSDNKTYANLCNLEVEACKPENTDKLQLLHDGPCP 110 Score = 38.3 bits (85), Expect = 0.093 Identities = 21/50 (42%), Positives = 26/50 (52%) Frame = +1 Query: 190 KCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPCPSS 339 +C C T E PVCG+D KTY N L A + LA + PCP+S Sbjct: 8 ECPRAC--TRELMPVCGTDQKTYDNMCLLERAACKDDGLMLAHEGPCPTS 55 Score = 36.7 bits (81), Expect = 0.28 Identities = 21/50 (42%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Frame = +1 Query: 193 CAENCISTPEYNPVCGSDNKTYKNQGRL---FCAQNCGVKVTLARQAPCP 333 C + C T EY PVCG+D KTY N L C K+ A PCP Sbjct: 166 CPKAC--TREYRPVCGTDGKTYPNPCILEMKACKPENMDKLQWAHDGPCP 213 >UniRef50_Q92033 Cluster: Vitellogenin; n=3; Anolis pulchellus|Rep: Vitellogenin - Anolis pulchellus (Common grass anole) Length = 680 Score = 41.5 bits (93), Expect = 0.010 Identities = 21/46 (45%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +1 Query: 199 ENCISTPEYNPVCGSDNKTYKNQGRLFCA--QNCGVKVTLARQAPC 330 E T EY PVCGSD TY N+ LFC ++ G +T+ R+ PC Sbjct: 10 EKAACTLEYAPVCGSDGITYDNK-CLFCVAKRDSGNTITIEREGPC 54 >UniRef50_Q8MZJ9 Cluster: Serine proteinase inhibitor PI-S; n=1; Neospora caninum|Rep: Serine proteinase inhibitor PI-S - Neospora caninum Length = 79 Score = 40.3 bits (90), Expect = 0.023 Identities = 15/29 (51%), Positives = 21/29 (72%) Frame = +1 Query: 199 ENCISTPEYNPVCGSDNKTYKNQGRLFCA 285 + CI + EY+PVCG+D KTY N+ + CA Sbjct: 30 QGCICSMEYDPVCGTDGKTYSNRCQAECA 58 >UniRef50_A7S7B8 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 450 Score = 39.9 bits (89), Expect = 0.031 Identities = 23/53 (43%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = +1 Query: 193 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLA--RQAPCPSSSK 345 C ENC ST + PVCG+DN TY N+ L Q C T+A R+ C K Sbjct: 258 CPENCSSTVD--PVCGTDNNTYDNE-CLMRQQACVANATVAVRRKGHCAKDGK 307 Score = 31.9 bits (69), Expect = 8.1 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +1 Query: 190 KCAENCISTPEYNPVCGSDNKTYKNQ 267 +C+E+C T PVCGSDN Y N+ Sbjct: 311 ECSEDCPKT--LKPVCGSDNNDYDNE 334 >UniRef50_UPI0000DB79FF Cluster: PREDICTED: similar to CG2264-PA, isoform A, partial; n=1; Apis mellifera|Rep: PREDICTED: similar to CG2264-PA, isoform A, partial - Apis mellifera Length = 386 Score = 38.7 bits (86), Expect = 0.071 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = +1 Query: 187 EKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPCPSS 339 ++ AE +S PVCGSD TY + R+ Q G+ + + PCP + Sbjct: 5 KRIAECTMSDGASTPVCGSDGVTYSSHCRVISKQCQGMSILIKHTGPCPET 55 >UniRef50_Q8T7L6 Cluster: Silk proteinase inhibitor; n=1; Bombyx mori|Rep: Silk proteinase inhibitor - Bombyx mori (Silk moth) Length = 65 Score = 38.7 bits (86), Expect = 0.071 Identities = 19/42 (45%), Positives = 23/42 (54%) Frame = +1 Query: 205 CISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPC 330 CI T EY PVCG++ TY N+ +L CA K A PC Sbjct: 23 CICTTEYRPVCGTNGVTYGNRCQLRCA-----KAIFAYDGPC 59 >UniRef50_Q8IPA4 Cluster: CG31704-PA; n=2; Sophophora|Rep: CG31704-PA - Drosophila melanogaster (Fruit fly) Length = 68 Score = 38.7 bits (86), Expect = 0.071 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = +1 Query: 202 NCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPC 330 +C Y+PVCGSD+ TY NQ L C G +T+ ++ C Sbjct: 26 SCPCPRNYDPVCGSDSVTYSNQCVLDCLIKEGRSITVEKKGRC 68 >UniRef50_Q0Q012 Cluster: Protease inhibitor-like protein; n=1; Antheraea mylitta|Rep: Protease inhibitor-like protein - Antheraea mylitta (Tasar silkworm) Length = 97 Score = 38.3 bits (85), Expect = 0.093 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 193 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGV 300 C + C T + PVCG+D TY+N + C CGV Sbjct: 61 CIKGCPVTLDRKPVCGTDGVTYENPSLVQCLVTCGV 96 Score = 35.9 bits (79), Expect = 0.50 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +1 Query: 253 TYKNQGRLFCAQNCGVKVTLARQAPC 330 TYKN L CAQ CGV VTL PC Sbjct: 2 TYKNGQHLMCAQFCGVDVTLKSFLPC 27 >UniRef50_Q45TK1 Cluster: Mantle protein 9; n=1; Pinctada fucata|Rep: Mantle protein 9 - Pinctada fucata (Pearl oyster) Length = 209 Score = 37.9 bits (84), Expect = 0.12 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = +1 Query: 199 ENCISTPEYNPVCGSDNKTYKN 264 E+CI T EYNP CG D +TY N Sbjct: 70 EDCICTAEYNPQCGVDGRTYSN 91 Score = 36.7 bits (81), Expect = 0.28 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +1 Query: 199 ENCISTPEYNPVCGSDNKTYKN 264 E+C+ T EYNP CG D +TY N Sbjct: 110 EDCVCTIEYNPQCGVDGRTYSN 131 Score = 34.7 bits (76), Expect = 1.1 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +1 Query: 202 NCISTPEYNPVCGSDNKTYKN 264 +C+ T EYNP CG D +TY N Sbjct: 31 DCVCTLEYNPQCGVDGRTYSN 51 >UniRef50_UPI00015B5FDA Cluster: PREDICTED: similar to hepatopancreas kazal-type proteinase inhibitor; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to hepatopancreas kazal-type proteinase inhibitor - Nasonia vitripennis Length = 79 Score = 37.5 bits (83), Expect = 0.16 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = +1 Query: 205 CISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTL--ARQAPC 330 C +T E +PVCG++ TY N L CA C VK ++ PC Sbjct: 35 CAATDELDPVCGNNGVTYPNLATLRCANEC-VKYSIHHMHHGPC 77 >UniRef50_A7T5U4 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 63 Score = 37.1 bits (82), Expect = 0.22 Identities = 19/36 (52%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = +1 Query: 193 CAENCISTPEYNPVCGSDNKTYKNQ---GRLFCAQN 291 C+ I T EY+P+CGSD KTY NQ R C QN Sbjct: 25 CSCPDICTFEYSPLCGSDGKTYDNQCEMERASCLQN 60 >UniRef50_UPI0000D569D0 Cluster: PREDICTED: similar to CG32354-PA; n=3; Endopterygota|Rep: PREDICTED: similar to CG32354-PA - Tribolium castaneum Length = 497 Score = 36.7 bits (81), Expect = 0.28 Identities = 21/56 (37%), Positives = 26/56 (46%) Frame = +1 Query: 178 QTIEKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPCPSSSK 345 QT C E+C P CGSD K Y N R+ ++NCG V A C S + Sbjct: 177 QTTRHCRESCWRNAR--PTCGSDGKIYANVCRM-KSKNCGKHVFEVPMAYCASQER 229 Score = 33.5 bits (73), Expect = 2.7 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +1 Query: 187 EKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPCPSS 339 E C +C P+ P+CGSD YK+ ++ CG V + C ++ Sbjct: 130 ENCPVDCKQAPQDGPICGSDGNVYKSTCQMKLL-TCGQGVVRTDKKYCQTT 179 Score = 32.7 bits (71), Expect = 4.6 Identities = 19/56 (33%), Positives = 29/56 (51%) Frame = +1 Query: 175 RQTIEKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPCPSSS 342 R + KC C S E + VCG+D +TY N+ L + C + + L+ PC + S Sbjct: 74 RSSGSKCEHRCGS--EKDLVCGTDGRTYLNRCMLE-VEICRLGIALSHLGPCNNIS 126 Score = 32.3 bits (70), Expect = 6.1 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +1 Query: 178 QTIEKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPCPS 336 +T C E C + N VCGSDNK Y+++ + NCG + + C S Sbjct: 384 RTTALCNEKC--PEDKNFVCGSDNKIYRSECEM-KRDNCGKHIFVVPMKRCLS 433 Score = 31.9 bits (69), Expect = 8.1 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +1 Query: 223 YNPVCGSDNKTYKNQGRLFCAQNCGVK--VTLARQAPC 330 Y+PVCGSDN TY N L +NC + VT+ C Sbjct: 448 YDPVCGSDNMTYSNTCFLE-IENCRSRSLVTMRHMGTC 484 >UniRef50_Q21157 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 655 Score = 36.7 bits (81), Expect = 0.28 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = +1 Query: 184 IEKCAENCISTPEYNPVCGSDNK-TYKNQGRLFCAQNCGVKVTLARQAPCPSS 339 +E C+ENC +NPVC D+K T+ + CA G+K + C S Sbjct: 442 LETCSENCHCDSFFNPVCSEDSKLTFLSPCHAGCADMPGIKFGASNWTNCGCS 494 >UniRef50_P84755 Cluster: Protease inhibitor 2; n=1; Cenchritis muricatus|Rep: Protease inhibitor 2 - Cenchritis muricatus (Beaded periwinkle) Length = 50 Score = 36.7 bits (81), Expect = 0.28 Identities = 18/49 (36%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = +1 Query: 187 EKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQ-NCGVKVTLARQAPC 330 E C T E+ PVCGSD TY N Q C +T+A C Sbjct: 2 EDCVGRKACTREWYPVCGSDGVTYSNPCNFSAQQEQCDPNITIAHMGEC 50 >UniRef50_UPI0000E47F76 Cluster: PREDICTED: similar to hepatopancreas kazal-type proteinase inhibitor, partial; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to hepatopancreas kazal-type proteinase inhibitor, partial - Strongylocentrotus purpuratus Length = 402 Score = 36.3 bits (80), Expect = 0.38 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 181 TIEKCAENCISTPEYNPVCGSDNKTYKNQ 267 TI+ C +NC Y+PVCGSD TY NQ Sbjct: 351 TIDPCKQNCPYL--YSPVCGSDGTTYLNQ 377 >UniRef50_O13274 Cluster: Sperm-activating protein; n=2; Clupea pallasii|Rep: Sperm-activating protein - Clupea pallasii (Pacific herring) Length = 94 Score = 36.3 bits (80), Expect = 0.38 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = +1 Query: 214 TPEYNPVCGSDNKTYKNQGRLFCA 285 T EY P+CGSD+ TY+N+ LFCA Sbjct: 39 TKEYRPICGSDDVTYENE-CLFCA 61 >UniRef50_Q7PWH1 Cluster: ENSANGP00000019497; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000019497 - Anopheles gambiae str. PEST Length = 63 Score = 36.3 bits (80), Expect = 0.38 Identities = 20/44 (45%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 202 NCISTP-EYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPC 330 +C + P Y PVCG+D KTY N+ L C VKV AR C Sbjct: 22 SCPACPANYLPVCGTDGKTYANECALECTVAPAVKV--ARSGEC 63 >UniRef50_Q0Q009 Cluster: Protease inhibitor-like protein; n=1; Antheraea mylitta|Rep: Protease inhibitor-like protein - Antheraea mylitta (Tasar silkworm) Length = 63 Score = 36.3 bits (80), Expect = 0.38 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +1 Query: 196 AENCISTPEYNPVCGSDNKTYKNQGRLFCA 285 A+ CI Y PVCG++ KTY N L CA Sbjct: 22 AQGCICPALYKPVCGTNGKTYSNPCSLKCA 51 >UniRef50_A7S1Y8 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 541 Score = 36.3 bits (80), Expect = 0.38 Identities = 21/54 (38%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +1 Query: 187 EKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQ-NCGVKVTLARQAPCPSSSK 345 +KCA C Y PVCGSDN TY N L A +T+ + C SS + Sbjct: 128 DKCAPICPKI--YRPVCGSDNVTYSNPCMLRSATCKSNGTITMKHRGKCGSSPR 179 Score = 36.3 bits (80), Expect = 0.38 Identities = 21/52 (40%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +1 Query: 187 EKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQ-NCGVKVTLARQAPCPSS 339 +KCA C Y PVCGSDN TY N L A +T+ + C SS Sbjct: 279 DKCAPIC--NKMYQPVCGSDNVTYSNPCMLRSATCKSNGTITMKHRGKCGSS 328 Score = 35.5 bits (78), Expect = 0.66 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +1 Query: 190 KCAENCISTPEYNPVCGSDNKTYKN 264 +C C T E NPVCGSD KTY N Sbjct: 179 RCMRRC--TKELNPVCGSDGKTYDN 201 Score = 35.5 bits (78), Expect = 0.66 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +1 Query: 190 KCAENCISTPEYNPVCGSDNKTYKN 264 +C C T E NPVCGSD KTY N Sbjct: 229 RCMRRC--TKELNPVCGSDGKTYDN 251 Score = 32.3 bits (70), Expect = 6.1 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = +1 Query: 184 IEKCAENCISTPEYNPVCGSDNKTYKNQ---GRLFCAQNCGVKVTLARQAPC 330 ++ C C + Y PVCG+D KTY N+ G C N G +TLA C Sbjct: 76 VDPCVRPCPAI--YMPVCGTDGKTYGNKCMLGAATCRSN-GT-ITLAYPGEC 123 >UniRef50_UPI00015B502F Cluster: PREDICTED: similar to CG2264A; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to CG2264A - Nasonia vitripennis Length = 719 Score = 35.9 bits (79), Expect = 0.50 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +1 Query: 229 PVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPC 330 PVCGSD TY NQ R+ Q G + + PC Sbjct: 220 PVCGSDGLTYPNQCRVISKQCLGESILVKHTGPC 253 >UniRef50_Q6V4H5 Cluster: Serine proteinase inhibitor; n=2; Astacoidea|Rep: Serine proteinase inhibitor - Procambarus clarkii (Red swamp crayfish) Length = 277 Score = 35.9 bits (79), Expect = 0.50 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +1 Query: 178 QTIEKCAENCISTPEYNPVCGSDNKTYKNQGRLFCA--QNCGVKVTLARQAPCPS 336 +T +C C T +Y+PVCG+D K Y N L A +N G+ + +A + C S Sbjct: 221 RTSNQCGSFC--TLQYDPVCGTDGKDYSNSCFLGIAACRNPGLNLKIAYKGRCNS 273 Score = 35.5 bits (78), Expect = 0.66 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = +1 Query: 208 ISTPEYNPVCGSDNKTYKNQGRL--FCAQNCGVKVTLARQAPC 330 + T EY PVCG+D KTY N+ L N +K+ +A + C Sbjct: 76 VCTLEYKPVCGTDGKTYSNRCALEVEACNNPQLKLRIAYEGEC 118 Score = 35.1 bits (77), Expect = 0.87 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = +1 Query: 202 NCISTPEYNPVCGSDNKTYKNQGRLFCA--QNCGVKVTLARQAPCPSSSK 345 N + Y PVCG+D KTY NQ L A N + + A Q C +S++ Sbjct: 176 NSVCPQIYQPVCGTDGKTYSNQCTLDVAACNNPQLHLRTAYQGECRTSNQ 225 Score = 32.7 bits (71), Expect = 4.6 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 193 CAENCISTPEYNPVCGSDNKTYKN 264 C + C T +Y+PVCG+D KTY N Sbjct: 124 CPKAC--TLQYDPVCGTDGKTYSN 145 >UniRef50_P82968 Cluster: Protease inhibitor; n=3; Eumetazoa|Rep: Protease inhibitor - Melithaea caledonica Length = 197 Score = 35.9 bits (79), Expect = 0.50 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +1 Query: 193 CAENC--ISTPEYNPVCGSDNKTYKNQGRLFCAQ-NCGVKVTLARQAPCPSSS 342 C C + T EYNP CG+D +TY N +L A+ ++TL C + S Sbjct: 93 CKPKCPTVCTLEYNPQCGTDGRTYGNPCQLKVAECESDGRITLDHPGECDACS 145 Score = 35.1 bits (77), Expect = 0.87 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +1 Query: 190 KCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQ-NCGVKVTLARQAPC 330 KC+ C T EYNP CG+D TY N L A+ ++T PC Sbjct: 48 KCSAAC--TKEYNPQCGTDGVTYANPCTLEYAKCKSDGEITFDHAGPC 93 >UniRef50_UPI0000E4884D Cluster: PREDICTED: similar to mucin 17; n=4; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to mucin 17 - Strongylocentrotus purpuratus Length = 6372 Score = 35.5 bits (78), Expect = 0.66 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = +1 Query: 223 YNPVCGSDNKTYKNQGRLFCAQNC 294 YNPVCGSDN+TY N L A C Sbjct: 6330 YNPVCGSDNRTYTNSCELQKATIC 6353 Score = 35.1 bits (77), Expect = 0.87 Identities = 18/40 (45%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = +1 Query: 220 EYNPVCGSDNKTYKNQGRL---FCAQNCGVKVTLARQAPC 330 +Y PVCG D KTY NQG L C QN + A + C Sbjct: 1128 KYKPVCGRDGKTYVNQGILQITACVQNDPNLASQAHKGEC 1167 >UniRef50_Q5CKD2 Cluster: T13C2.5; n=2; Cryptosporidium|Rep: T13C2.5 - Cryptosporidium hominis Length = 1299 Score = 35.5 bits (78), Expect = 0.66 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = +1 Query: 214 TPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPCPSSSK 345 T +Y P+CGSD KTY N AQ + CP+ K Sbjct: 206 TADYRPICGSDGKTYSNVALFRNAQCDDENLDFVHWGECPTEVK 249 Score = 32.7 bits (71), Expect = 4.6 Identities = 18/49 (36%), Positives = 21/49 (42%) Frame = +1 Query: 193 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPCPSS 339 C C T EYNPVCG++ TY N AQ V + C S Sbjct: 628 CKTPC--TKEYNPVCGTNRVTYSNPCEFRNAQCDDVNLEFLHWGKCSKS 674 Score = 31.9 bits (69), Expect = 8.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 214 TPEYNPVCGSDNKTYKN 264 T +Y P+CGSD KTY N Sbjct: 952 TMDYRPICGSDGKTYTN 968 >UniRef50_A7S7E2 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 295 Score = 35.5 bits (78), Expect = 0.66 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +1 Query: 190 KCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLAR--QAPC 330 +C + P Y+P+CG+D KTY N L A C + ++ R + PC Sbjct: 117 RCECDLRPDPAYDPICGTDGKTYNNDKDLESAA-CAQQTSIVRWHKGPC 164 Score = 34.7 bits (76), Expect = 1.1 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +1 Query: 190 KCAENCISTPEYNPVCGSDNKTYKN 264 KC + T EY PVCGSD TY N Sbjct: 2 KCVCSAACTREYAPVCGSDGNTYNN 26 >UniRef50_O00468 Cluster: Agrin precursor; n=41; Euteleostomi|Rep: Agrin precursor - Homo sapiens (Human) Length = 2045 Score = 35.5 bits (78), Expect = 0.66 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +1 Query: 190 KCAENCISTPEYNPVCGSDNKTYKNQGRL-FCAQNCGVKVTLARQAPC 330 +C + C S Y+PVCGSD TY + L A G ++ +AR+ PC Sbjct: 489 ECLQACSSL--YDPVCGSDGVTYGSACELEATACTLGREIQVARKGPC 534 >UniRef50_Q4SCB6 Cluster: Chromosome undetermined SCAF14659, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome undetermined SCAF14659, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 960 Score = 35.1 bits (77), Expect = 0.87 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 229 PVCGSDNKTYKNQGRLFCAQ-NCGVKVTLARQAPCPSSSK*F 351 PVCGSD TY N+ L AQ N ++ + R+ PC +K F Sbjct: 42 PVCGSDASTYSNECELEKAQCNAQRRIKVLRKGPCCKVTKNF 83 Score = 34.7 bits (76), Expect = 1.1 Identities = 20/48 (41%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +1 Query: 193 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVK--VTLARQAPC 330 C C S P NPVCGSD K Y N+ L A+ C + + + Q PC Sbjct: 637 CDFTCQSVPN-NPVCGSDGKNYSNECELKKAR-CEKQEHLLIQNQGPC 682 >UniRef50_Q9VSK1 Cluster: CG32354-PA; n=4; Diptera|Rep: CG32354-PA - Drosophila melanogaster (Fruit fly) Length = 662 Score = 35.1 bits (77), Expect = 0.87 Identities = 19/43 (44%), Positives = 24/43 (55%) Frame = +1 Query: 184 IEKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTL 312 ++ CA C E+ PVCGSDNKTY N L +NC T+ Sbjct: 603 LKGCARIC--PREFEPVCGSDNKTYLNDCFLE-IENCRANQTV 642 Score = 33.9 bits (74), Expect = 2.0 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 3/53 (5%) Frame = +1 Query: 193 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGV---KVTLARQAPCPSSS 342 C C + E +PVCG+D +TY N+ L Q+C V V L+ PC ++S Sbjct: 221 CKHRC--STEKDPVCGTDGRTYLNRCML-RVQSCRVGLAAVKLSHVGPCSNTS 270 Score = 33.1 bits (72), Expect = 3.5 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = +1 Query: 187 EKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPCPSS 339 E C +C S P+ PVC SD Y + + + CG V + C S+ Sbjct: 274 ESCPVDCNSAPKDGPVCSSDGNVYNSTCEM-KLKTCGQGVVKTSRKHCQST 323 >UniRef50_Q177V9 Cluster: Putative uncharacterized protein; n=1; Aedes aegypti|Rep: Putative uncharacterized protein - Aedes aegypti (Yellowfever mosquito) Length = 84 Score = 35.1 bits (77), Expect = 0.87 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = +1 Query: 202 NCISTPEYNPVCGSDNKTYKNQGRLFCA 285 +C Y PVCGSDN TY N L CA Sbjct: 33 SCACPLSYQPVCGSDNVTYSNDCVLNCA 60 >UniRef50_Q6MZW2 Cluster: Follistatin-related protein 4 precursor; n=40; Euteleostomi|Rep: Follistatin-related protein 4 precursor - Homo sapiens (Human) Length = 842 Score = 35.1 bits (77), Expect = 0.87 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +1 Query: 190 KCAENCISTPEYNPVCGSDNKTYKNQGRLF-CAQNCGVKVTLARQAPC 330 +C E C P Y PVCGSD + Y+N +L A G ++T+ C Sbjct: 88 QCLEAC--RPSYVPVCGSDGRFYENHCKLHRAACLLGKRITVIHSKDC 133 >UniRef50_UPI00005472E7 Cluster: PREDICTED: similar to Elastase inhibitor isoform 2; n=1; Danio rerio|Rep: PREDICTED: similar to Elastase inhibitor isoform 2 - Danio rerio Length = 73 Score = 34.7 bits (76), Expect = 1.1 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +1 Query: 208 ISTPEYNPVCGSDNKTYKNQGRLFCAQNC-GVKVTLARQAPCPSS 339 + T EY PVCG D TY N+ L N V V + + C SS Sbjct: 29 VCTREYKPVCGDDGITYSNECMLRWESNAKEVVVNVKHEGKCESS 73 >UniRef50_Q6PQG3 Cluster: Kazal-like serine protease inhibitor EPI10; n=2; Phytophthora infestans|Rep: Kazal-like serine protease inhibitor EPI10 - Phytophthora infestans (Potato late blight fungus) Length = 224 Score = 34.7 bits (76), Expect = 1.1 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +1 Query: 223 YNPVCGSDNKTYKNQGRL--FCAQNCGVKVTLARQAPCPSSSK 345 Y PVCGSD +TY N+ L + +T+ + PCPS + Sbjct: 171 YAPVCGSDGETYPNECDLGITSCNHPEQNITMVGEGPCPSQEQ 213 Score = 31.9 bits (69), Expect = 8.1 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Frame = +1 Query: 187 EKCAENCISTPEYNPVCGSDNKTYKNQGRL---FCAQNCGVKVTLARQAPCPSS 339 + C+ C+ Y PVCGS+ +TY N L C N G +T A C S+ Sbjct: 24 DNCSFGCLDV--YKPVCGSNGETYSNSCYLRLASCKSNNG--ITEAGDGECAST 73 >UniRef50_Q5TVI8 Cluster: ENSANGP00000026934; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000026934 - Anopheles gambiae str. PEST Length = 120 Score = 34.7 bits (76), Expect = 1.1 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 199 ENCISTPEYNPVCGSDNKTYKNQGRLFC 282 E C T Y+PVCG++N+TY N L C Sbjct: 36 ELCCCTMHYSPVCGNNNRTYHNYCILRC 63 >UniRef50_Q1XEF1 Cluster: Putative serine protease inhibitor; n=1; Hydra vulgaris|Rep: Putative serine protease inhibitor - Hydra attenuata (Hydra) (Hydra vulgaris) Length = 168 Score = 34.7 bits (76), Expect = 1.1 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +1 Query: 193 CAENCISTPEYNPVCGSDNKTYKNQ 267 C+ C T EYNPVCGSD KTY + Sbjct: 121 CSFPC--TREYNPVCGSDGKTYATE 143 >UniRef50_Q16N95 Cluster: Secreted modular calcium-binding protein; n=2; Culicidae|Rep: Secreted modular calcium-binding protein - Aedes aegypti (Yellowfever mosquito) Length = 598 Score = 34.7 bits (76), Expect = 1.1 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +1 Query: 229 PVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPC 330 PVCG+DN+TY + L AQ G +V+L + C Sbjct: 20 PVCGTDNQTYPTRCHLIRAQCSGHQVSLKHRGTC 53 >UniRef50_Q0Q008 Cluster: Protease inhibitor-like protein; n=1; Antheraea mylitta|Rep: Protease inhibitor-like protein - Antheraea mylitta (Tasar silkworm) Length = 72 Score = 34.7 bits (76), Expect = 1.1 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +1 Query: 205 CISTPEYNPVCGSDNKTYKNQGRLFCA 285 CI T +Y PVC + TY N +L+CA Sbjct: 33 CICTAQYEPVCSTQGCTYGNACQLYCA 59 >UniRef50_A7RRU4 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1139 Score = 34.7 bits (76), Expect = 1.1 Identities = 17/52 (32%), Positives = 33/52 (63%), Gaps = 2/52 (3%) Frame = +1 Query: 193 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNC--GVKVTLARQAPCPSSS 342 C ++C +Y PVCG+++KTY N + A++C G + +A++ PC +++ Sbjct: 565 CKQDC--PLDYEPVCGTNSKTYLN-SCVLQAESCYIGRWIRVAKKGPCVTNA 613 >UniRef50_A0NC57 Cluster: ENSANGP00000029787; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000029787 - Anopheles gambiae str. PEST Length = 101 Score = 34.7 bits (76), Expect = 1.1 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +1 Query: 196 AENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPC 330 A+ C Y P+C S+ +TY N CA+ +++ QA C Sbjct: 47 AKPCACPRTYKPLCASNGQTYNNHCAFKCAKQLNATLSVKAQARC 91 >UniRef50_P23499 Cluster: SPARC-like protein 1 precursor; n=6; Gnathostomata|Rep: SPARC-like protein 1 precursor - Coturnix coturnix japonica (Japanese quail) Length = 676 Score = 34.7 bits (76), Expect = 1.1 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +1 Query: 205 CISTPEYNPVCGSDNKTYKNQGRLF 279 C ST +Y VCG+DNKTY +LF Sbjct: 474 CPSTKDYKRVCGTDNKTYDGTCQLF 498 >UniRef50_UPI0000D99687 Cluster: PREDICTED: similar to agrin; n=1; Macaca mulatta|Rep: PREDICTED: similar to agrin - Macaca mulatta Length = 1817 Score = 34.3 bits (75), Expect = 1.5 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +1 Query: 190 KCAENCISTPEYNPVCGSDNKTYKNQGRL-FCAQNCGVKVTLARQAPCPSSSK 345 +C + C S Y+PVCG D TY + L A G ++ +AR+ PC S+ Sbjct: 384 ECRQACSSL--YDPVCGGDGVTYGSTCELEATACTLGREIRVARKGPCGRCSE 434 >UniRef50_UPI000051A338 Cluster: PREDICTED: similar to agrin isoform 1; n=1; Apis mellifera|Rep: PREDICTED: similar to agrin isoform 1 - Apis mellifera Length = 2397 Score = 34.3 bits (75), Expect = 1.5 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +1 Query: 175 RQTIEKCAENCISTPEYNPVCGSDNKTYKNQ 267 RQ +C E C E+ PVCGSD KTY N+ Sbjct: 641 RQPGCRCGEQC--GLEFAPVCGSDGKTYSNE 669 Score = 33.1 bits (72), Expect = 3.5 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +1 Query: 190 KCAENCISTPEYNPVCGSDNKTYKN 264 +C +C ST E PVCGSDN TY N Sbjct: 497 QCPTDCPSTSE--PVCGSDNVTYTN 519 >UniRef50_Q9NQ38 Cluster: Serine protease inhibitor Kazal-type 5 precursor (Lympho-epithelial Kazal-type-related inhibitor) (LEKTI) [Contains: Hemofiltrate peptide HF6478; Hemofiltrate peptide HF7665]; n=29; Theria|Rep: Serine protease inhibitor Kazal-type 5 precursor (Lympho-epithelial Kazal-type-related inhibitor) (LEKTI) [Contains: Hemofiltrate peptide HF6478; Hemofiltrate peptide HF7665] - Homo sapiens (Human) Length = 1064 Score = 34.3 bits (75), Expect = 1.5 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = +1 Query: 223 YNPVCGSDNKTYKNQGRLFCAQNC--GVKVTLARQAPCPSSS 342 Y VCG+D KTY N+ L CA+N G ++ + + C SS+ Sbjct: 115 YEAVCGTDGKTYDNRCAL-CAENAKTGSQIGVKSEGECKSSN 155 >UniRef50_Q4RSP1 Cluster: Chromosome 12 SCAF14999, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 12 SCAF14999, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 343 Score = 33.9 bits (74), Expect = 2.0 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +1 Query: 193 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQ 288 CA +C + PVCG+D KTYK++ L A+ Sbjct: 110 CAPDCSNITWKGPVCGTDGKTYKDECALLKAK 141 >UniRef50_Q6WVJ6 Cluster: Hepatopancreas kazal-type proteinase inhibitor; n=4; Penaeidae|Rep: Hepatopancreas kazal-type proteinase inhibitor - Penaeus monodon (Penoeid shrimp) Length = 312 Score = 33.9 bits (74), Expect = 2.0 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 223 YNPVCGSDNKTYKNQGRLFCAQNC--GVKVTLARQAPC 330 ++PVCGSD TY N +L A NC G ++LA PC Sbjct: 276 WDPVCGSDGVTYSNLCQLEIA-NCLNGGGISLAHPGPC 312 Score = 33.1 bits (72), Expect = 3.5 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 4/53 (7%) Frame = +1 Query: 199 ENC--ISTPEYNPVCGSDNKTYKNQGRLFCAQNC--GVKVTLARQAPCPSSSK 345 E+C + + +Y+PVCGSD TY N L A +C +TLA + C K Sbjct: 69 ESCDILCSTDYDPVCGSDGVTYSNLCNLEVA-DCFSDEDITLAYEGECKEVKK 120 >UniRef50_Q16PW6 Cluster: Putative uncharacterized protein; n=1; Aedes aegypti|Rep: Putative uncharacterized protein - Aedes aegypti (Yellowfever mosquito) Length = 599 Score = 33.9 bits (74), Expect = 2.0 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 223 YNPVCGSDNKTYKNQGRL---FCAQNCGVKVTLARQAPCPSSSK 345 YNPVCG+D KTYK + +L C Q + +A + C +S + Sbjct: 384 YNPVCGTDGKTYKTECQLKKRACRQE-STTLVMAYKGHCQTSCR 426 >UniRef50_Q5DT21 Cluster: Serine protease inhibitor Kazal type 9; n=5; Eutheria|Rep: Serine protease inhibitor Kazal type 9 - Homo sapiens (Human) Length = 86 Score = 33.9 bits (74), Expect = 2.0 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = +1 Query: 223 YNPVCGSDNKTYKNQGRLFCAQ 288 Y+P+CGSD KTYKN FC++ Sbjct: 50 YDPICGSDGKTYKND-CFFCSK 70 >UniRef50_UPI0000E474D2 Cluster: PREDICTED: similar to agrin; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to agrin - Strongylocentrotus purpuratus Length = 1397 Score = 33.5 bits (73), Expect = 2.7 Identities = 20/47 (42%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +1 Query: 193 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVK-VTLARQAPC 330 C E C+ + YNPVCGSD Y N+ L A K VT+ Q C Sbjct: 198 CPEICLES--YNPVCGSDGVDYNNECDLNAAACSQQKSVTVVFQGLC 242 Score = 32.3 bits (70), Expect = 6.1 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 3/49 (6%) Frame = +1 Query: 193 CAENCISTPEYNPVCGSDNKTYKNQ---GRLFCAQNCGVKVTLARQAPC 330 C NC ++ NPVCGSD TY N R C N + + PC Sbjct: 267 CDSNCPNSV-INPVCGSDGVTYDNDCEINRAACLSNLEDILITFTEGPC 314 >UniRef50_Q0BYE4 Cluster: Kazal domain protein; n=1; Hyphomonas neptunium ATCC 15444|Rep: Kazal domain protein - Hyphomonas neptunium (strain ATCC 15444) Length = 124 Score = 33.5 bits (73), Expect = 2.7 Identities = 21/48 (43%), Positives = 25/48 (52%), Gaps = 5/48 (10%) Frame = +1 Query: 178 QTIEKCAENCISTP-----EYNPVCGSDNKTYKNQGRLFCAQNCGVKV 306 +TI A C+S P EY PVCG D +TY N+ AQ GV V Sbjct: 69 RTIADAAGICLSAPQMCTYEYAPVCGCDGETYGNK---CAAQAAGVSV 113 >UniRef50_Q6PQG4 Cluster: Kazal-like serine protease inhibitor EPI9; n=1; Phytophthora infestans|Rep: Kazal-like serine protease inhibitor EPI9 - Phytophthora infestans (Potato late blight fungus) Length = 80 Score = 33.5 bits (73), Expect = 2.7 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 181 TIEKCAENCISTPEYNPVCGSDNKTYKNQ 267 T +KC C T +Y P+CGSD TY N+ Sbjct: 31 TGDKCPTRC--TRDYRPICGSDGITYANK 57 >UniRef50_Q6PPA1 Cluster: Kazal-like serine protease inhibitor PbraEPI1; n=1; Phytophthora brassicae|Rep: Kazal-like serine protease inhibitor PbraEPI1 - Phytophthora brassicae Length = 147 Score = 33.5 bits (73), Expect = 2.7 Identities = 20/51 (39%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +1 Query: 187 EKCAENCISTPEYNPVCGSDNKTYKNQGRLFCAQ-NCGVKVTLARQAPCPS 336 +KC E C T Y PVCGSD TY N L A +T + C S Sbjct: 91 DKCPEAC--TMIYKPVCGSDGVTYGNDCTLGIASCESDGSITKVSEGECAS 139 >UniRef50_A7S7E5 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 659 Score = 33.5 bits (73), Expect = 2.7 Identities = 21/57 (36%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = +1 Query: 175 RQTIEKCAENCISTPEYNPVCGSDNKTYKNQGRLFC-AQNCGVKVTLARQAPCPSSS 342 RQ + C ++ PVCGSD +TY N RL G VT+ RQ C S Sbjct: 388 RQAVCACPRFEDCPRDFRPVCGSDLRTYVNLCRLQVEVCQTGRAVTVLRQGACDPCS 444 Score = 32.7 bits (71), Expect = 4.6 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 3/32 (9%) Frame = +1 Query: 220 EYNPVCGSDNKTYKNQGRL---FCAQNCGVKV 306 E +PVCGSD KTY+N+ +L C N V++ Sbjct: 474 EASPVCGSDGKTYENECKLRVESCKANQNVRI 505 >UniRef50_P00998 Cluster: Pancreatic secretory trypsin inhibitor; n=3; Theria|Rep: Pancreatic secretory trypsin inhibitor - Sus scrofa (Pig) Length = 56 Score = 33.5 bits (73), Expect = 2.7 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = +1 Query: 193 CAENCISTPE-YNPVCGSDNKTYKNQGRLFCAQN--CGVKVTLARQAPC 330 C P+ YNPVCG+D TY N+ + C++N V + + PC Sbjct: 9 CTSEVSGCPKIYNPVCGTDGITYSNE-CVLCSENKKRQTPVLIQKSGPC 56 >UniRef50_P19883 Cluster: Follistatin precursor; n=57; Vertebrata|Rep: Follistatin precursor - Homo sapiens (Human) Length = 344 Score = 33.5 bits (73), Expect = 2.7 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 193 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQ 288 CA +C + PVCG D KTY+N+ L A+ Sbjct: 118 CAPDCSNITWKGPVCGLDGKTYRNECALLKAR 149 >UniRef50_UPI0000E2041C Cluster: PREDICTED: similar to Serine protease inhibitor Kazal-type 2 precursor (Acrosin-trypsin inhibitor) (HUSI-II) isoform 2; n=2; Pan troglodytes|Rep: PREDICTED: similar to Serine protease inhibitor Kazal-type 2 precursor (Acrosin-trypsin inhibitor) (HUSI-II) isoform 2 - Pan troglodytes Length = 134 Score = 33.1 bits (72), Expect = 3.5 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +1 Query: 223 YNPVCGSDNKTYKNQGRL-FCAQNCGVKVTLARQAPC 330 +NPVCGSD TY N+ L + G + + R PC Sbjct: 98 FNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC 134 >UniRef50_Q82V56 Cluster: Kazal-type serine protease inhibitor domain; n=1; Nitrosomonas europaea|Rep: Kazal-type serine protease inhibitor domain - Nitrosomonas europaea Length = 235 Score = 33.1 bits (72), Expect = 3.5 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +1 Query: 208 ISTPEYNPVCGSDNKTYKN 264 I T E+NPVCG D KTY N Sbjct: 151 ICTREFNPVCGCDGKTYGN 169 >UniRef50_Q6PQG2 Cluster: Kazal-like serine protease inhibitor EPI11; n=1; Phytophthora infestans|Rep: Kazal-like serine protease inhibitor EPI11 - Phytophthora infestans (Potato late blight fungus) Length = 84 Score = 33.1 bits (72), Expect = 3.5 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +1 Query: 208 ISTPEYNPVCGSDNKTYKNQGRLFCAQ-NCGVKVTLARQAPCPSS 339 + T + PVCGSD TY N L A ++T CP+S Sbjct: 31 LCTDLFAPVCGSDGVTYSNDCYLLLADCESAARITKVSDGKCPTS 75 >UniRef50_Q7Q348 Cluster: ENSANGP00000014954; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000014954 - Anopheles gambiae str. PEST Length = 71 Score = 33.1 bits (72), Expect = 3.5 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +1 Query: 205 CISTPEYNPVCGSDNKTYKNQGRLFCAQN 291 C Y PVCG+D KTY NQ L C N Sbjct: 26 CGCPRSYRPVCGTDLKTYSNQCVLDCRIN 54 >UniRef50_Q7PP79 Cluster: ENSANGP00000013791; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000013791 - Anopheles gambiae str. PEST Length = 475 Score = 33.1 bits (72), Expect = 3.5 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 223 YNPVCGSDNKTYKNQGRL---FCAQNCGVKVTLARQAPCPSSSK 345 YNPVCG+D +TYK + +L C Q + +A + C +S K Sbjct: 361 YNPVCGTDGRTYKTECQLKKRACRQEI-TSLMVAYKGHCQTSCK 403 >UniRef50_A7SCV7 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 312 Score = 33.1 bits (72), Expect = 3.5 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = +1 Query: 214 TPEYNPVCGSDNKTYKNQGRLFCAQNC--GVKVTLARQAPCPSS 339 T EY PVCG+D KTY N+ + A C VT+A C S+ Sbjct: 6 TYEYMPVCGTDGKTYGNKCEM-RASACLKSTMVTVAYPGECESN 48 >UniRef50_A7S1Y9 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 70 Score = 33.1 bits (72), Expect = 3.5 Identities = 18/37 (48%), Positives = 20/37 (54%), Gaps = 3/37 (8%) Frame = +1 Query: 190 KCAENCISTPEYNPVCGSDNKTYKNQGRL---FCAQN 291 KC I T EY+P CGSD K Y N +L C QN Sbjct: 23 KCVCPQICTMEYSPRCGSDGKIYSNPCQLRVAACNQN 59 >UniRef50_P20155 Cluster: Serine protease inhibitor Kazal-type 2 precursor; n=10; Eutheria|Rep: Serine protease inhibitor Kazal-type 2 precursor - Homo sapiens (Human) Length = 84 Score = 33.1 bits (72), Expect = 3.5 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +1 Query: 223 YNPVCGSDNKTYKNQGRL-FCAQNCGVKVTLARQAPC 330 +NPVCGSD TY N+ L + G + + R PC Sbjct: 48 FNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC 84 >UniRef50_O96790 Cluster: Serine protease inhibitor dipetalogastin precursor; n=6; Eumetazoa|Rep: Serine protease inhibitor dipetalogastin precursor - Dipetalogaster maximus (Blood-sucking bug) Length = 351 Score = 33.1 bits (72), Expect = 3.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 205 CISTPEYNPVCGSDNKTYKNQGRLFCA 285 C +NPVCG+D KTY N L CA Sbjct: 303 CNCFRNFNPVCGTDGKTYGNLCMLGCA 329 Score = 32.3 bits (70), Expect = 6.1 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +1 Query: 199 ENCISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPC 330 ++C+ Y PVCG+D +TY N L C + + LA C Sbjct: 244 KSCMCPKIYKPVCGTDGRTYPNICVLKCHISSNPGLGLAHLGEC 287 >UniRef50_Q0ASJ9 Cluster: Proteinase inhibitor I1, Kazal precursor; n=1; Maricaulis maris MCS10|Rep: Proteinase inhibitor I1, Kazal precursor - Maricaulis maris (strain MCS10) Length = 113 Score = 32.7 bits (71), Expect = 4.6 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +1 Query: 181 TIEKCAENCISTPEYNPVCGSDNKTYKN 264 TI + A T EY PVCG+D +TY N Sbjct: 61 TIAEVAAEISCTQEYAPVCGADGETYGN 88 >UniRef50_A7RI85 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 203 Score = 32.7 bits (71), Expect = 4.6 Identities = 19/39 (48%), Positives = 22/39 (56%), Gaps = 5/39 (12%) Frame = +1 Query: 229 PVCGSDNKTYKNQGRLF---CAQNCGVK--VTLARQAPC 330 PVCGSD KTY+N L CA G K +TL + PC Sbjct: 124 PVCGSDGKTYRNGCELATAKCALPKGQKRQLTLKHRGPC 162 >UniRef50_A7DZ96 Cluster: AGRin (Synaptic protein) homolog family member; n=3; Caenorhabditis|Rep: AGRin (Synaptic protein) homolog family member - Caenorhabditis elegans Length = 1473 Score = 32.7 bits (71), Expect = 4.6 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 214 TPEYNPVCGSDNKTYKNQGRL 276 T E+ VCGSD KTY N+ RL Sbjct: 477 TDEFKEVCGSDGKTYSNECRL 497 >UniRef50_UPI00015555AF Cluster: PREDICTED: similar to serine protease inhibitor Kazal-type 5, partial; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar to serine protease inhibitor Kazal-type 5, partial - Ornithorhynchus anatinus Length = 338 Score = 32.3 bits (70), Expect = 6.1 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 229 PVCGSDNKTYKNQGRLFCAQNCGVK--VTLARQAPCPS 336 PVCG+D KTY+N+ L CA+N + V + + C S Sbjct: 78 PVCGTDGKTYRNRCTL-CAENLKTRSLVDVKSEGKCES 114 >UniRef50_Q6PVV6 Cluster: SPARCL1; n=3; Danio rerio|Rep: SPARCL1 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 224 Score = 32.3 bits (70), Expect = 6.1 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +1 Query: 220 EYNPVCGSDNKTYKNQGRLFCAQNCGVKVT 309 ++ VCG+DNKTY + LF A CG++ T Sbjct: 37 DFEHVCGTDNKTYDSSCHLF-ATKCGLEGT 65 >UniRef50_Q9VYH8 Cluster: CG15721-PA; n=1; Drosophila melanogaster|Rep: CG15721-PA - Drosophila melanogaster (Fruit fly) Length = 843 Score = 32.3 bits (70), Expect = 6.1 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 178 QTIEKCAENCISTPEYNPVCGSDNKTYKN 264 +T+E C +NC +YNPVCG T +N Sbjct: 89 ETLEVCPDNC--QDQYNPVCGKYKDTRRN 115 >UniRef50_Q9N9H5 Cluster: Guanylyl cyclase; n=3; Plasmodium falciparum|Rep: Guanylyl cyclase - Plasmodium falciparum Length = 4226 Score = 32.3 bits (70), Expect = 6.1 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +3 Query: 393 IHYFVIWKLP*IAVFLCNTVFLYLFILCLN 482 ++ FVI +LP + LCN +FL LFI+ N Sbjct: 2893 LYTFVILRLPFVNAVLCNIIFLGLFIIRFN 2922 >UniRef50_Q5CQH1 Cluster: Extracellular protein with a signal peptide and 8 kazal repeats; n=2; Cryptosporidium|Rep: Extracellular protein with a signal peptide and 8 kazal repeats - Cryptosporidium parvum Iowa II Length = 688 Score = 32.3 bits (70), Expect = 6.1 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 184 IEKCAENCISTPEYNPVCGSDNKTY 258 I+KC ++C + +CGSDNKTY Sbjct: 348 IDKCRDDCPFGKTLSYICGSDNKTY 372 >UniRef50_Q1EF71 Cluster: Male reproductive tract-specific Kazal-type proteinase inhibitor; n=1; Macrobrachium rosenbergii|Rep: Male reproductive tract-specific Kazal-type proteinase inhibitor - Macrobrachium rosenbergii (Giant fresh water prawn) Length = 134 Score = 32.3 bits (70), Expect = 6.1 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 193 CAENCISTPEYNPVCGSDNKTYKNQGRLFCAQNC-GVKVTLARQAPC 330 C C T Y PVCGSD +TY N+ L A+ C V + + C Sbjct: 31 CPVRC--TLRYIPVCGSDGRTYGNKCHLDNARLCDNSNVQVVHEGEC 75 >UniRef50_O62054 Cluster: Putative uncharacterized protein; n=1; Caenorhabditis elegans|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 404 Score = 32.3 bits (70), Expect = 6.1 Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 4/73 (5%) Frame = +3 Query: 273 TILCPKLWSQSDFGQASPVPVFIKVILIKYNLYFILIKC----SIHYFVIWKLP*IAVFL 440 T++C L+S+ + SP V + + K+ L+F+LI C SI +VI K+ + VF Sbjct: 307 TVIC--LFSKIVYFHKSPKNVETRFFMKKWYLWFLLINCVIWSSIPLYVIGKVGNV-VFS 363 Query: 441 CNTVFLYLFILCL 479 N++F L C+ Sbjct: 364 PNSLFWALLTFCV 376 >UniRef50_A4QPC2 Cluster: SLCO5A1 protein; n=2; Homo/Pan/Gorilla group|Rep: SLCO5A1 protein - Homo sapiens (Human) Length = 793 Score = 32.3 bits (70), Expect = 6.1 Identities = 17/53 (32%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = +1 Query: 175 RQTIEKCAENC-ISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPC 330 R C NC EY PVCGSD TY N C + + + C Sbjct: 494 RNLTGSCNVNCGCKIHEYEPVCGSDGITYFNPCLAGCVNSGNLSTGIRNYTEC 546 >UniRef50_Q6C3Z4 Cluster: Similar to sp|P27514 Saccharomyces cerevisiae YNR013c; n=1; Yarrowia lipolytica|Rep: Similar to sp|P27514 Saccharomyces cerevisiae YNR013c - Yarrowia lipolytica (Candida lipolytica) Length = 846 Score = 32.3 bits (70), Expect = 6.1 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 344 FDEDGHGACLAKVTLTPQFWAQNSLPWFL 258 FD D CLA + L FWA +LP F+ Sbjct: 398 FDSDAQNNCLAIIVLASFFWATEALPLFV 426 >UniRef50_Q4WAD7 Cluster: Integral membrane protein; n=6; Trichocomaceae|Rep: Integral membrane protein - Aspergillus fumigatus (Sartorya fumigata) Length = 361 Score = 32.3 bits (70), Expect = 6.1 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = +3 Query: 288 KLWSQSDFGQASPVPVFIKVILIKYNLYFILIKCSIHYFVIWKLP*IAV--FLCNTVFLY 461 K W+ S + VF+K +L LY I+ C I + +W L + V F C V Y Sbjct: 89 KFWAPSMAFVKISIIVFLKRLLGSVRLYAIISNCLIAFIAVWALTAVLVNTFQCTPVQYY 148 >UniRef50_Q9H2Y9 Cluster: Solute carrier organic anion transporter family member 5A1; n=38; Euteleostomi|Rep: Solute carrier organic anion transporter family member 5A1 - Homo sapiens (Human) Length = 848 Score = 32.3 bits (70), Expect = 6.1 Identities = 17/53 (32%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = +1 Query: 175 RQTIEKCAENC-ISTPEYNPVCGSDNKTYKNQGRLFCAQNCGVKVTLARQAPC 330 R C NC EY PVCGSD TY N C + + + C Sbjct: 549 RNLTGSCNVNCGCKIHEYEPVCGSDGITYFNPCLAGCVNSGNLSTGIRNYTEC 601 >UniRef50_A7MBT7 Cluster: Putative uncharacterized protein; n=2; Danio rerio|Rep: Putative uncharacterized protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 293 Score = 31.9 bits (69), Expect = 8.1 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = +1 Query: 232 VCGSDNKTYKNQGRLFCA---QNCGVKVTLARQAPC 330 +CGSD KTYKN +L A Q+ G +T+ PC Sbjct: 113 LCGSDGKTYKNICQLQAAQHKQSKGPMLTMVHHGPC 148 >UniRef50_Q968S7 Cluster: Silk protease inhibitor 2 precursor; n=1; Galleria mellonella|Rep: Silk protease inhibitor 2 precursor - Galleria mellonella (Wax moth) Length = 58 Score = 31.9 bits (69), Expect = 8.1 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 Query: 208 ISTPEYNPVCGSDNKTYKN 264 + T E++PVCG D KTY N Sbjct: 23 VCTTEWDPVCGKDGKTYSN 41 >UniRef50_Q5CY32 Cluster: Putative uncharacterized protein; n=2; Cryptosporidium|Rep: Putative uncharacterized protein - Cryptosporidium parvum Iowa II Length = 1259 Score = 31.9 bits (69), Expect = 8.1 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 8/59 (13%) Frame = +2 Query: 185 LRNARRIAFQHQNTTPCVVA--------IIKLTKTREDYFVPKIVESK*LWPGKPRARL 337 L N +A++H TP ++ I+K + +++Y+ P+I+E+ L PG RA + Sbjct: 338 LPNLEHLAYKHVALTPSIMTQIKKLYNLIVKEKEKKQNYYTPQIIEALDLLPGIVRAEI 396 >UniRef50_A7T1D7 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 298 Score = 31.9 bits (69), Expect = 8.1 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 3/55 (5%) Frame = +1 Query: 175 RQTIEKCAENCISTPEYNPVCGSDNKTYKNQ---GRLFCAQNCGVKVTLARQAPC 330 R+T ++C+ IS PVCG++ KTY+N R C++ +VT+A + PC Sbjct: 88 RRTHQRCSTLAIS-----PVCGTNGKTYQNMCFLERRACSKQ--NRVTVAYRGPC 135 >UniRef50_A7SIW2 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 336 Score = 31.9 bits (69), Expect = 8.1 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 8/59 (13%) Frame = +1 Query: 190 KCAENCIST-PEY-NPVCGSDNKTYKNQ---GRLFCAQNCGVKVTLARQAPC---PSSS 342 K + C+S P++ PVCGSD TY N R+ C K+T+ + PC PSS+ Sbjct: 52 KASCECLSECPDHIKPVCGSDGVTYPNHCELHRIACVHT--KKITIRSKGPCEEIPSSA 108 >UniRef50_P08481 Cluster: Double-headed protease inhibitor, submandibular gland; n=2; Felidae|Rep: Double-headed protease inhibitor, submandibular gland - Panthera leo (Lion) Length = 112 Score = 31.9 bits (69), Expect = 8.1 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 5/32 (15%) Frame = +1 Query: 187 EKCAENC-----ISTPEYNPVCGSDNKTYKNQ 267 +KC C I T EY P+CGSD K Y N+ Sbjct: 58 DKCQIECTNYSAICTMEYFPLCGSDGKVYSNK 89 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 507,534,378 Number of Sequences: 1657284 Number of extensions: 10238277 Number of successful extensions: 22012 Number of sequences better than 10.0: 99 Number of HSP's better than 10.0 without gapping: 21262 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22002 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 28855457139 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -