BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_D04 (504 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like pr... 22 3.6 AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 21 6.3 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 21 6.3 >AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like protein protein. Length = 242 Score = 21.8 bits (44), Expect = 3.6 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 99 ILMAYITKQVLAQVSAY 149 I++A ITK L QVS + Sbjct: 118 IMLAIITKMTLTQVSTW 134 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 21.0 bits (42), Expect = 6.3 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +2 Query: 332 HKMWS*SLPIKYTF*NLSYNCTKTIIYYID 421 H S LP+ ++ + SYNC + ID Sbjct: 219 HSESSKVLPLLFSVSSSSYNCEVLFSFLID 248 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 21.0 bits (42), Expect = 6.3 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +1 Query: 73 YNSLYFIQSSLWLTL 117 +NSLY + LW+T+ Sbjct: 247 HNSLYSLHLLLWITV 261 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,689 Number of Sequences: 336 Number of extensions: 2972 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11944578 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -