BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_D04 (504 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00046-3|AAC47045.2| 244|Caenorhabditis elegans Hypothetical pr... 28 3.3 AF003151-2|AAK18919.3| 277|Caenorhabditis elegans Prion-like-(q... 27 5.8 >U00046-3|AAC47045.2| 244|Caenorhabditis elegans Hypothetical protein R13F6.5 protein. Length = 244 Score = 28.3 bits (60), Expect = 3.3 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +1 Query: 133 HKYLLMLD*NMLSIIILIKWNNYYHYYNKIASIILAHFI 249 HKY L+ L + I W+ YY ++ I S+ A + Sbjct: 124 HKYFLLFLVWPLQLAIFTIWHGYYDFWKTIRSVYTAEIL 162 >AF003151-2|AAK18919.3| 277|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 24 protein. Length = 277 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/54 (22%), Positives = 26/54 (48%) Frame = -2 Query: 401 SWCNYNLDSKMYILWVMINSTFYETYCCNAIGSCVYNYYDDT*VSIVTCSFIKC 240 S+C YN+ + ++ + + C A +C++ + VS+ CS+ +C Sbjct: 43 SYC-YNMSTSAMVMVNFVKAGCSRWRCMLAKDTCIFTTFQMVPVSLCCCSYDRC 95 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,955,544 Number of Sequences: 27780 Number of extensions: 215669 Number of successful extensions: 449 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 436 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 449 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 967231538 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -