BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_D01 (653 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 49 3e-08 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 23 3.4 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 7.9 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 7.9 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 49.2 bits (112), Expect = 3e-08 Identities = 19/60 (31%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Frame = +2 Query: 248 DPCMKVHCSAGRVCEINEHGE-AICNCIKECPYETDSRRKVCTNFNETWSSDCEVYRQRC 424 DPC +C G+ CE++ + A+C C+++CP R VC + + +++ CE++R C Sbjct: 80 DPCASKYCGIGKECELSPNSTIAVCVCMRKCPRR---HRPVCASNGKIYANHCELHRAAC 136 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 22.6 bits (46), Expect = 3.4 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 3/25 (12%) Frame = -1 Query: 437 GRG---RGSAVGTPRSPMTRSR*SL 372 GRG GS G+PRSP + SR S+ Sbjct: 310 GRGSVHNGSNNGSPRSPESNSRCSV 334 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 7.9 Identities = 12/39 (30%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +2 Query: 488 YGTCREMPEC--SENEMSDFPRRMRDWLFNIMRDLAERR 598 + C ++ E S NE++ P +RD DL E R Sbjct: 427 FRNCSDLKELDLSGNELTSVPDALRDLALLKTLDLGENR 465 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = +1 Query: 103 RGHLRVGAPRERHGGEPGRETI 168 +G G P +R+GGE ++ + Sbjct: 532 KGAAAAGQPSKRNGGETNKQEL 553 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,937 Number of Sequences: 438 Number of extensions: 3944 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -