BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_C24 (558 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY735443-1|AAU08018.1| 163|Anopheles gambiae bursicon protein. 25 2.2 AY735442-1|AAU08017.1| 163|Anopheles gambiae bursicon protein. 25 2.2 AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsiv... 24 3.9 AF071163-1|AAC79999.1| 218|Anopheles gambiae glutathione S-tran... 23 5.1 AF071160-4|AAC79992.1| 218|Anopheles gambiae glutathione S-tran... 23 5.1 >AY735443-1|AAU08018.1| 163|Anopheles gambiae bursicon protein. Length = 163 Score = 24.6 bits (51), Expect = 2.2 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 235 GGRSSRQSPIKQIPTLWLLAFPACIPTTFQPRPSYA 342 GG + P + +L +P C+P +P PS+A Sbjct: 30 GGSHYSSDDCQVTPVIHVLQYPGCVP---KPIPSFA 62 >AY735442-1|AAU08017.1| 163|Anopheles gambiae bursicon protein. Length = 163 Score = 24.6 bits (51), Expect = 2.2 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 235 GGRSSRQSPIKQIPTLWLLAFPACIPTTFQPRPSYA 342 GG + P + +L +P C+P +P PS+A Sbjct: 30 GGSHYSSDDCQVTPVIHVLQYPGCVP---KPIPSFA 62 >AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsive protein 1 protein. Length = 447 Score = 23.8 bits (49), Expect = 3.9 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -2 Query: 347 GLAYEGRGWKVVG 309 G+A GRGW++VG Sbjct: 303 GIATYGRGWRLVG 315 >AF071163-1|AAC79999.1| 218|Anopheles gambiae glutathione S-transferase D1-3 protein. Length = 218 Score = 23.4 bits (48), Expect = 5.1 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 Query: 145 IKPWQLNVREQHCLRTFLPGNIFILDMWSS 56 +KP L + QHC+ T + + F+L W S Sbjct: 39 MKPEFLKLNPQHCIPTLVDEDGFVL--WES 66 >AF071160-4|AAC79992.1| 218|Anopheles gambiae glutathione S-transferase protein. Length = 218 Score = 23.4 bits (48), Expect = 5.1 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 Query: 145 IKPWQLNVREQHCLRTFLPGNIFILDMWSS 56 +KP L + QHC+ T + + F+L W S Sbjct: 39 MKPEFLKLNPQHCIPTLVDEDGFVL--WES 66 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 665,195 Number of Sequences: 2352 Number of extensions: 13952 Number of successful extensions: 25 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52142868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -