BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_C23 (575 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC337.03 |||conserved eukaryotic protein|Schizosaccharomyces p... 28 1.1 SPAC2F3.18c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 26 3.4 SPAC6G9.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr ... 26 4.5 SPAC13G7.13c |msa1|SPAC6C3.01c|RNA-binding protein Msa1|Schizosa... 25 7.9 >SPBC337.03 |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 387 Score = 27.9 bits (59), Expect = 1.1 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = +1 Query: 16 NRHGATLTNTHIP-GIGDKLSVAGKVNLFHNNDHDLSAKAFATRNMPTISHLPSTNTV 186 N+ T T+T G GDK S AGK N+ + S + + S+ PS N+V Sbjct: 252 NKESTTATSTLTDAGFGDKSSTAGKHNVETTSPPSSSPNSDDAYSPQVDSYSPSINSV 309 >SPAC2F3.18c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 110 Score = 26.2 bits (55), Expect = 3.4 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -3 Query: 117 IMVVVMKQVHFTSNRQFISNSRNMSVCEGSSVAV 16 I V + + F ++ S N+SV EGSS+ + Sbjct: 73 IYAVCLMNIFFRNSENCFKYSMNLSVAEGSSILI 106 >SPAC6G9.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 681 Score = 25.8 bits (54), Expect = 4.5 Identities = 16/70 (22%), Positives = 29/70 (41%) Frame = +1 Query: 58 IGDKLSVAGKVNLFHNNDHDLSAKAFATRNMPTISHLPSTNTVGGGLEYMFKDKIGASAS 237 I ++ G L NN AF + + T + S++++ GL+ + K Sbjct: 197 ISSSSNLGGNPGLIANNPSASKNFAFTSGSSSTNNSTTSSSSMANGLQSISKHSAAFPLL 256 Query: 238 AAHTDFFNKN 267 + T FF +N Sbjct: 257 SNATSFFGEN 266 >SPAC13G7.13c |msa1|SPAC6C3.01c|RNA-binding protein Msa1|Schizosaccharomyces pombe|chr 1|||Manual Length = 533 Score = 25.0 bits (52), Expect = 7.9 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +2 Query: 152 PPFPIYHQPTLLVVVSNICSRTRSVHQRAPL 244 P F + + +C +TRS HQ+ PL Sbjct: 404 PAFAFLRFDSQQAAYAAVCGKTRSPHQKKPL 434 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,338,979 Number of Sequences: 5004 Number of extensions: 47269 Number of successful extensions: 119 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 119 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 246098644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -