BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_C13 (630 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase... 24 4.6 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 23 8.0 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 8.0 >AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase subunit 2 protein. Length = 686 Score = 23.8 bits (49), Expect = 4.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 254 TQEYAGYHGNKHN 292 +Q Y YHGN HN Sbjct: 357 SQFYGNYHGNLHN 369 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 23.0 bits (47), Expect = 8.0 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 292 VVFIAMVSCILLCYPSMYLACNSPHSVVLQS 200 V+ IA + IL L CN PH VV ++ Sbjct: 565 VLNIAKLVIILYLRSWTVLTCNVPHEVVFRA 595 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.0 bits (47), Expect = 8.0 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +1 Query: 214 PNAESCKQGTYLDNTGVC 267 PN E CK+ ++ G C Sbjct: 377 PNCERCKENFFMREDGYC 394 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 596,221 Number of Sequences: 2352 Number of extensions: 11555 Number of successful extensions: 29 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61468785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -