BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_C13 (630 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC026344-1|AAH26344.2| 239|Homo sapiens hypothetical protein FL... 32 1.9 AK000496-1|BAA91205.1| 239|Homo sapiens protein ( Homo sapiens ... 32 1.9 >BC026344-1|AAH26344.2| 239|Homo sapiens hypothetical protein FLJ20489 protein. Length = 239 Score = 31.9 bits (69), Expect = 1.9 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -1 Query: 354 RPFHMTYFYLINFYFLTFIFLLCLLPWYPAYSC 256 RPF M F ++F+FL F FL L P C Sbjct: 100 RPFQMNLFSFLSFFFLFFFFLRWSLTLSPRLEC 132 >AK000496-1|BAA91205.1| 239|Homo sapiens protein ( Homo sapiens cDNA FLJ20489 fis, clone KAT08285. ). Length = 239 Score = 31.9 bits (69), Expect = 1.9 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -1 Query: 354 RPFHMTYFYLINFYFLTFIFLLCLLPWYPAYSC 256 RPF M F ++F+FL F FL L P C Sbjct: 100 RPFQMNLFSFLSFFFLFFFFLRWSLTLSPRLEC 132 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,533,365 Number of Sequences: 237096 Number of extensions: 1434948 Number of successful extensions: 3180 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3060 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3180 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6860268620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -