BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_C13 (630 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY075507-1|AAL68316.1| 452|Drosophila melanogaster RE54525p pro... 30 3.0 AE014296-3396|AAF51624.2| 452|Drosophila melanogaster CG4786-PA... 30 3.0 >AY075507-1|AAL68316.1| 452|Drosophila melanogaster RE54525p protein. Length = 452 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +1 Query: 103 KETFSSDSGLNKTNTAFAFSSMNTSVSTIKSTMIEVP 213 +ET SSDS + T F + T+ ST+ ST +E+P Sbjct: 277 QETSSSDSAMETTTNPTTFEA--TATSTVSSTSMELP 311 >AE014296-3396|AAF51624.2| 452|Drosophila melanogaster CG4786-PA protein. Length = 452 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +1 Query: 103 KETFSSDSGLNKTNTAFAFSSMNTSVSTIKSTMIEVP 213 +ET SSDS + T F + T+ ST+ ST +E+P Sbjct: 277 QETSSSDSAMETTTNPTTFEA--TATSTVSSTSMELP 311 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,339,598 Number of Sequences: 53049 Number of extensions: 438957 Number of successful extensions: 1436 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1406 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1436 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2621070450 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -